KEGG   Bacillus subtilis subsp. subtilis 168: BSU27390Help
Entry
BSU27390          CDS       T00010                                 

Gene name
yrrK
Definition
(RefSeq) Holliday junction resolvase
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU27390 (yrrK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU27390 (yrrK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-GeneID: 937357
NCBI-ProteinID: NP_390617
Pasteur: BG13792
BSORF: BG13792
UniProt: O34634
Structure
PDB: 

Position
complement(2797399..2797815)
Genome map
AA seq 138 aa AA seqDB search
MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLG
FPKNMNGTVGPRGEASQTFAKVLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKV
IDKMAAVMILQGYLDSLN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagaatattaggactcgatttaggaaccaaaacactcggtgtagctctgagcgatgaa
atgggctggactgctcaaggcattgagaccataaagataaatgaagcagaaggcgattat
ggtttatcccgtttatctgaactgataaaggactatactatagataaaatcgtgctcggc
tttcctaagaacatgaacggaacagtcggcccgagaggcgaagccagccaaacatttgcg
aaagtgcttgaaacaacgtacaatgttcctgttgtgctgtgggacgagcgtcttaccaca
atggcggctgaaaaaatgctgattgcagctgacgtcagcaggcaaaaacgaaaaaaagtc
attgataaaatggcggctgttatgattttacaaggatatcttgacagcttaaattaa

DBGET integrated database retrieval system