KEGG   Bacillus subtilis subsp. subtilis 168: BSU27390
Entry
BSU27390          CDS       T00010                                 

Symbol
yrrK
Name
(RefSeq) Holliday junction resolvase
  KO
K07447  putative pre-16S rRNA nuclease [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU27390 (yrrK)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU27390 (yrrK)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA processing factors
   BSU27390 (yrrK)
SSDB
Motif
Pfam: RuvX
Other DBs
NCBI-GeneID: 937357
NCBI-ProteinID: NP_390617
Pasteur: BG13792
BSORF: BG13792
UniProt: O34634 A0A6M3ZHU3
Structure
PDB: 
1VHX

Position
complement(2797399..2797815)
AA seq 138 aa
MRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLG
FPKNMNGTVGPRGEASQTFAKVLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKV
IDKMAAVMILQGYLDSLN
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagaatattaggactcgatttaggaaccaaaacactcggtgtagctctgagcgatgaa
atgggctggactgctcaaggcattgagaccataaagataaatgaagcagaaggcgattat
ggtttatcccgtttatctgaactgataaaggactatactatagataaaatcgtgctcggc
tttcctaagaacatgaacggaacagtcggcccgagaggcgaagccagccaaacatttgcg
aaagtgcttgaaacaacgtacaatgttcctgttgtgctgtgggacgagcgtcttaccaca
atggcggctgaaaaaatgctgattgcagctgacgtcagcaggcaaaaacgaaaaaaagtc
attgataaaatggcggctgttatgattttacaaggatatcttgacagcttaaattaa

DBGET integrated database retrieval system