KEGG   Bacillus subtilis subsp. subtilis 168: BSU27400Help
Entry
BSU27400          CDS       T00010                                 

Gene name
yrzL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IreB CHASE3
Motif
Other DBs
NCBI-GeneID: 2914283
NCBI-ProteinID: YP_054589
Pasteur: BG14184
BSORF: BG14184
UniProt: Q7WY61
Position
complement(2797823..2798089)
Genome map
AA seq 88 aa AA seqDB search
MSSFDKTMKFNFSDDSAETNVNEVLITVYDALQEKGYNPINQIVGYLLSGDPAYIPRHRD
ARNLIRKLERDELIEELVKSYLEQHKEA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgtttgataaaacgatgaaatttaatttctccgatgattctgctgagactaac
gtaaatgaggtgctgattacagtgtatgacgcgcttcaggaaaagggctacaatccaatc
aaccagattgtcggatacttgctgtcaggtgatcccgcttatattcctaggcatcgtgac
gctcgcaatttaattcgcaaacttgaaagagacgaattaatcgaggaattggtaaagtct
tatttagaacagcataaagaggcgtaa

DBGET integrated database retrieval system