KEGG   Bacillus subtilis subsp. subtilis 168: BSU27400
Entry
BSU27400          CDS       T00010                                 

Gene name
yrzL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: IreB CHASE3
Other DBs
NCBI-GeneID: 2914283
NCBI-ProteinID: YP_054589
Pasteur: BG14184
BSORF: BG14184
UniProt: Q7WY61 A0A6M3ZEV5
Position
complement(2797823..2798089)
AA seq 88 aa
MSSFDKTMKFNFSDDSAETNVNEVLITVYDALQEKGYNPINQIVGYLLSGDPAYIPRHRD
ARNLIRKLERDELIEELVKSYLEQHKEA
NT seq 267 nt   +upstreamnt  +downstreamnt
gtgagctcgtttgataaaacgatgaaatttaatttctccgatgattctgctgagactaac
gtaaatgaggtgctgattacagtgtatgacgcgcttcaggaaaagggctacaatccaatc
aaccagattgtcggatacttgctgtcaggtgatcccgcttatattcctaggcatcgtgac
gctcgcaatttaattcgcaaacttgaaagagacgaattaatcgaggaattggtaaagtct
tatttagaacagcataaagaggcgtaa

DBGET integrated database retrieval system