KEGG   Bacillus subtilis subsp. subtilis 168: BSU27420Help
Entry
BSU27420          CDS       T00010                                 

Gene name
yrrI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport
Motif
Other DBs
NCBI-GeneID: 937557
NCBI-ProteinID: NP_390619
Pasteur: BG13791
BSORF: BG13791
UniProt: O34472
Position
complement(2801141..2802202)
Genome map
AA seq 353 aa AA seqDB search
MLQKPVQLLLWVAICLLVLLTVYVFFMLDMLWSPFWLVIKTIFIPLIISIFISYLLLPVT
EWLHGKGLPRTLSILVIYVLFFGGIGWALYKGVPVLIVQLTDLSENIPMFAETYNGLLLH
VHNHTDDWPDGMHHRIDKMIRQTEAFFAGTIEGAISGIRNVLDYFLIAATIPFLVFYMVK
DIELMKKTVWYLTPKSWRKRGSAFLRDVDDSLGDYIRGQLLVCLILGVIAGISFWVFGLP
YPLILGLISGVTNVIPYFGPFIGAVPALLIAMTISVKAVLVVVITVFILQFMEGNILSPF
IVGRSLKMHPVVIMLALLAGGELAGIVGMILAVPATAVLKVMMIHFLRMRTEH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctccaaaaaccggtgcagcttttgttgtgggtggctatttgtttgctggttctgtta
acagtctatgtcttttttatgcttgatatgttatggtcacccttttggctcgtcataaaa
acgatctttattcccttgatcatttctatttttatatcttatttattgcttccggtcaca
gaatggctgcatggcaaaggattgcctaggactttgagcatcttggtcatttatgttctt
ttttttggcgggattggctgggcgttgtataaaggggtgcctgttttaatcgtgcagctg
acggatttgtcagaaaatatacccatgtttgccgaaacgtataacgggcttcttcttcat
gtgcataaccatacggatgactggcctgatggtatgcatcaccgtatagataaaatgatc
cgccagacggaggcgttttttgcgggaacgatcgagggtgcgatcagcgggatccgcaat
gtgcttgattacttcttaattgctgcaacaatcccttttctcgtgttttatatggtgaag
gacattgagttaatgaaaaagacagtatggtacttgactccgaagtcgtggagaaagcgg
ggcagcgcctttttgcgggatgtggatgattcgcttggcgattatatccgcggccagctt
ttggtctgcttgattcttggcgtgattgcaggcatttcgttctgggtatttgggcttccg
tatccgctgatacttggccttatctctggggtaacgaatgtcatcccgtattttggccct
ttcatcggagctgttcctgcgttgttaattgcgatgacgatctcagtcaaggcggttctt
gttgtggtgattacggtgtttattctgcagtttatggaaggaaatatcctcagtccgttc
attgtcggcagaagccttaaaatgcatccggtcgttatcatgcttgcactccttgccgga
ggggagcttgcgggtatcgtcgggatgattctggctgttcctgcgacggctgttttaaaa
gtaatgatgatccattttttgcggatgaggacggagcattga

DBGET integrated database retrieval system