KEGG   Bacillus subtilis subsp. subtilis 168: BSU27440Help
Entry
BSU27440          CDS       T00010                                 

Gene name
glnH
Definition
(RefSeq) ABC transporter substrate-binding protein GlnH
  KO
K10039  aspartate/glutamate/glutamine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00228  Aspartate/glutamate/glutamine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27440 (glnH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27440 (glnH)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter [MD:M00228]
    BSU27440 (glnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd LPAM_2
Motif
Other DBs
NCBI-GeneID: 938139
NCBI-ProteinID: NP_390621
Pasteur: BG11486
BSORF: BG11486
UniProt: O34563
Position
2803108..2803929
Genome map
AA seq 273 aa AA seqDB search
MKKIFSLALISLFAVILLAACGSKGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFG
LKNPSSGEIEGFDIDIAKQIAKDILGDEKKAQFKEVTSKTRIPMLQNGDIDAIVATMTIT
EERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEAS
VLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQS
ALAKEINASLKKMKSDGRYDEIYKKWIKEDPAE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattttttctttagcattgatttctttattcgctgtcatcttgcttgccgct
tgcggcagcaagggatcaaacggagaagcctcaaaggagagcaaaaaagatacgctagcc
gccattaaagacaatgacaaaattgtcttcggcgtaaaaacggacactcgactgttcggt
cttaaaaatccaagctcaggtgagattgagggttttgatattgatattgctaaacaaatc
gctaaagacattttaggtgatgagaaaaaagctcaatttaaagaggtcacctcaaaaaca
aggattcctatgctgcaaaacggggatatcgacgccattgtcgccacaatgacgatcact
gaagaacgaaaaaaggaagttgacttttctgatgtctatttcgaggccgggcaatcgctt
ctcgtgaaaaaaggcagcaaaatcaagagtgtcgagaatcttggcaaaggctcaaaagtt
cttgcagtaaaaggctccacctcctctcaaaacattcgtgaaaaggcgcctgaagcatct
gttttagaatttgaaaactacgcagaagcctttacagcccttaaatcggggcaaggcgat
gccctcaccacagataatgcaattttatatggaatggctgatgaaaataaaaattatcaa
ttaacaggaaagccttttacagatgagccttacgggatcgccgtgaaaaaagggcaatct
gctctcgcgaaagaaatcaacgcttcacttaaaaagatgaagtcggatggcagatacgat
gaaatttataaaaaatggatcaaagaagacccagctgaataa

DBGET integrated database retrieval system