KEGG   Bacillus subtilis subsp. subtilis 168: BSU27450
Entry
BSU27450          CDS       T00010                                 

Gene name
glnM
Definition
(RefSeq) glutamine ABC transporter permease protein GlnM
  KO
K10040  aspartate/glutamate/glutamine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27450 (glnM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27450 (glnM)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter
    BSU27450 (glnM)
SSDB
Motif
Pfam: BPD_transp_1 Keratin_assoc
Other DBs
NCBI-GeneID: 935975
NCBI-ProteinID: NP_390622
Pasteur: BG11487
BSORF: BG11487
UniProt: O34671 A0A6M4JK77
Position
2803990..2804640
AA seq 216 aa
MNVSILFDNFSMYMDGFYHTLLASVIALAGSFVLGVAVAVMRITVFKPLQWLGTAYVEFI
RNIPLLLITFVFYFGLPNAGLRLDGFQAGTVALTIYTSAFIAEAIRAGIQSVSKGQMEAA
RSSGFTYSQAMLHIILPQAIKIVIPPLGNQFLNLVKNSSILGVVAGLDLMYQADLVSSST
LVVFDVYIFVALFYLVLTIPLSIGVNYLEKRLEKSY
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaatgtgtcaattcttttcgataacttcagcatgtatatggacggtttttaccatacc
ttgctcgcaagtgttatcgcgctggccggcagttttgtcctcggcgttgctgtagcggtt
atgagaataacagtctttaagccgctgcaatggctcgggaccgcatatgtagaattcatc
cgcaacatccctcttcttttaattacctttgttttctatttcggacttccaaacgcaggc
ctgaggcttgacggttttcaagcgggaacggttgctctcaccatttatacctctgcgttt
atcgctgaagccatcagagcaggcatccagtctgtttcaaaagggcagatggaagcggca
cgctcgtcaggctttacctacagccaagccatgctccatatcattttgccgcaggcaatc
aaaatcgtcattccgcctttaggcaatcaatttttaaacttagtcaaaaactcttcgatt
cttggggttgtggccggattggatcttatgtaccaagccgatttagtttcgtcgagcaca
ctcgttgtatttgatgtttatatttttgtggcgcttttttacttagtgctgacgattccg
cttagcatcggtgttaactatctggaaaaacggctggaaaaaagctattga

DBGET integrated database retrieval system