KEGG   Bacillus subtilis subsp. subtilis 168: BSU27450Help
Entry
BSU27450          CDS       T00010                                 

Gene name
glnM
Definition
(RefSeq) glutamine ABC transporter permease protein GlnM
  KO
K10040  aspartate/glutamate/glutamine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00228  Aspartate/glutamate/glutamine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27450 (glnM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27450 (glnM)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter [MD:M00228]
    BSU27450 (glnM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Keratin_assoc
Motif
Other DBs
NCBI-GeneID: 935975
NCBI-ProteinID: NP_390622
Pasteur: BG11487
BSORF: BG11487
UniProt: O34671
Position
2803990..2804640
Genome map
AA seq 216 aa AA seqDB search
MNVSILFDNFSMYMDGFYHTLLASVIALAGSFVLGVAVAVMRITVFKPLQWLGTAYVEFI
RNIPLLLITFVFYFGLPNAGLRLDGFQAGTVALTIYTSAFIAEAIRAGIQSVSKGQMEAA
RSSGFTYSQAMLHIILPQAIKIVIPPLGNQFLNLVKNSSILGVVAGLDLMYQADLVSSST
LVVFDVYIFVALFYLVLTIPLSIGVNYLEKRLEKSY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtcaattcttttcgataacttcagcatgtatatggacggtttttaccatacc
ttgctcgcaagtgttatcgcgctggccggcagttttgtcctcggcgttgctgtagcggtt
atgagaataacagtctttaagccgctgcaatggctcgggaccgcatatgtagaattcatc
cgcaacatccctcttcttttaattacctttgttttctatttcggacttccaaacgcaggc
ctgaggcttgacggttttcaagcgggaacggttgctctcaccatttatacctctgcgttt
atcgctgaagccatcagagcaggcatccagtctgtttcaaaagggcagatggaagcggca
cgctcgtcaggctttacctacagccaagccatgctccatatcattttgccgcaggcaatc
aaaatcgtcattccgcctttaggcaatcaatttttaaacttagtcaaaaactcttcgatt
cttggggttgtggccggattggatcttatgtaccaagccgatttagtttcgtcgagcaca
ctcgttgtatttgatgtttatatttttgtggcgcttttttacttagtgctgacgattccg
cttagcatcggtgttaactatctggaaaaacggctggaaaaaagctattga

DBGET integrated database retrieval system