KEGG   Bacillus subtilis subsp. subtilis 168: BSU27460Help
Entry
BSU27460          CDS       T00010                                 

Gene name
glnP
Definition
(RefSeq) glutamine ABC transporter permease protein GlnP
  KO
K10040  aspartate/glutamate/glutamine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00228  Aspartate/glutamate/glutamine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU27460 (glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27460 (glnP)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Aspartate/glutamate/glutamine transporter [MD:M00228]
    BSU27460 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 937556
NCBI-ProteinID: NP_390623
Pasteur: BG11488
BSORF: BG11488
UniProt: O34606
Position
2804657..2805313
Genome map
AA seq 218 aa AA seqDB search
MDFIGAYSQEHLAFLWDGFLVTLYVAFISIILSFFFGLIAGTLRYAKVPVLSQLIAVLVE
TIRNLPLLLIIFFTFFALPEIGIKLEITAAAITALTIFESAMLSEIIRSGLKSIDKGQIE
AARSSGLSYTQTLFFIVMPQALRRMVPPIVSQFISLLKDTSLAVVIALPELIHNAQIING
QSADGSYFFPIFLLAALMYFAVNYSLSLAARRLEVRQT
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttggatttcatcggtgcttattcacaggagcatttagcgtttttatgggatggctttctc
gtcaccttgtacgttgctttcatctccatcattctgagctttttcttcggtttaatcgca
ggcaccctgcgttatgcgaaagttcccgttctttctcaattgattgcagttctcgttgaa
acgatcagaaacctccccttgctgttaattattttctttacgttttttgcccttccggaa
attgggattaagcttgaaattacagctgctgcaattacagcactaacgatttttgaatcc
gctatgctatctgaaattatccgaagcggactgaaatcaattgacaaaggacaaattgaa
gcggcgcgctcctccgggctgagctatacacagaccctgttctttatcgttatgccgcaa
gcgcttcgccgcatggttccgcccatcgtaagccagtttatttctttattaaaagataca
tcgctcgctgttgtgatcgccctgcctgaactgattcacaacgcgcaaattattaacggc
caaagcgctgacggcagttattttttcccgatctttttacttgcggcccttatgtatttc
gcagtcaactacagcctttcactcgcagcaagacgcctcgaggtccggcaaacatag

DBGET integrated database retrieval system