KEGG   Bacillus subtilis subsp. subtilis 168: BSU27468
Entry
BSU27468          CDS       T00010                                 

Symbol
yrzQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3918 OAM_alpha
Other DBs
NCBI-GeneID: 8302994
NCBI-ProteinID: YP_003097766
UniProt: C0H461 A0A6M4JNK8
Position
complement(2805348..2805479)
AA seq 43 aa
MNRTMTSLLAMGAGALVYRMATQSDMLNNRSMKRMRRRITKMF
NT seq 132 nt   +upstreamnt  +downstreamnt
atgaatcggacgatgacttctcttttggcaatgggagccggagctctcgtgtaccgaatg
gcgactcaatctgacatgctgaataatcgaagcatgaagcggatgagaagaagaattacg
aaaatgttttaa

DBGET integrated database retrieval system