KEGG   Bacillus subtilis subsp. subtilis 168: BSU27468Help
Entry
BSU27468          CDS       T00010                                 

Gene name
yrzQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3918 OAM_alpha
Motif
Other DBs
NCBI-GeneID: 8302994
NCBI-ProteinID: YP_003097766
UniProt: C0H461
Position
complement(2805348..2805479)
Genome map
AA seq 43 aa AA seqDB search
MNRTMTSLLAMGAGALVYRMATQSDMLNNRSMKRMRRRITKMF
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggacgatgacttctcttttggcaatgggagccggagctctcgtgtaccgaatg
gcgactcaatctgacatgctgaataatcgaagcatgaagcggatgagaagaagaattacg
aaaatgttttaa

DBGET integrated database retrieval system