KEGG   Bacillus subtilis subsp. subtilis 168: BSU27470
Entry
BSU27470          CDS       T00010                                 

Symbol
yrrD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PRC
Other DBs
NCBI-GeneID: 937552
NCBI-ProteinID: NP_390624
Pasteur: BG13790
BSORF: BG13790
UniProt: O34402 A0A6M4JKG1
Position
complement(2805704..2806228)
AA seq 174 aa
MSLRRKAKPKPVQQKVVDHTLRTCHEVEGFPVYSERTSSYLGTISDICFSLKGDCLGFIL
AQKRFLHHHHALLRACDISSIFDDRILASVSSEQLLPLPKSCFTYEQMKMKLVKSQEGDI
LGMLEDVYFCLDRGIIVAYELSDGFFSDLAGSKRQIQRADSLVEVRKDEIVLNG
NT seq 525 nt   +upstreamnt  +downstreamnt
atgagtctaaggcgcaaagcaaaacctaagcctgttcaacaaaaggtggttgatcacact
ttgagaacatgccatgaagtagaaggattcccagtatactcagaacgaacttctagttat
ctcgggacaatttccgatatttgtttttctctgaaaggagattgtcttgggtttattctt
gcacaaaaacgctttttgcatcatcatcatgcgctattacgggcgtgtgatatctcttcc
atttttgatgaccgcatattggcttcggtcagttcagaacagcttttgcctcttccgaaa
tcatgcttcacatacgagcagatgaagatgaagcttgtgaaatcgcaagagggggatata
ttggggatgctggaagatgtatacttttgtttggacaggggcataatcgtagcatatgaa
ctctcggacggtttcttttctgacctggcgggaagcaagcgccagatccaaagagcggat
tcgcttgtcgaggtgcggaaagacgagatcgttctgaacggatag

DBGET integrated database retrieval system