KEGG   Bacillus subtilis subsp. subtilis 168: BSU27470Help
Entry
BSU27470          CDS       T00010                                 

Gene name
yrrD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC
Motif
Other DBs
NCBI-GeneID: 937552
NCBI-ProteinID: NP_390624
Pasteur: BG13790
BSORF: BG13790
UniProt: O34402
Position
complement(2805704..2806228)
Genome map
AA seq 174 aa AA seqDB search
MSLRRKAKPKPVQQKVVDHTLRTCHEVEGFPVYSERTSSYLGTISDICFSLKGDCLGFIL
AQKRFLHHHHALLRACDISSIFDDRILASVSSEQLLPLPKSCFTYEQMKMKLVKSQEGDI
LGMLEDVYFCLDRGIIVAYELSDGFFSDLAGSKRQIQRADSLVEVRKDEIVLNG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgagtctaaggcgcaaagcaaaacctaagcctgttcaacaaaaggtggttgatcacact
ttgagaacatgccatgaagtagaaggattcccagtatactcagaacgaacttctagttat
ctcgggacaatttccgatatttgtttttctctgaaaggagattgtcttgggtttattctt
gcacaaaaacgctttttgcatcatcatcatgcgctattacgggcgtgtgatatctcttcc
atttttgatgaccgcatattggcttcggtcagttcagaacagcttttgcctcttccgaaa
tcatgcttcacatacgagcagatgaagatgaagcttgtgaaatcgcaagagggggatata
ttggggatgctggaagatgtatacttttgtttggacaggggcataatcgtagcatatgaa
ctctcggacggtttcttttctgacctggcgggaagcaagcgccagatccaaagagcggat
tcgcttgtcgaggtgcggaaagacgagatcgttctgaacggatag

DBGET integrated database retrieval system