KEGG   Bacillus subtilis subsp. subtilis 168: BSU27490Help
Entry
BSU27490          CDS       T00010                                 

Gene name
yrrB
Definition
(RefSeq) TPR repeat-containing protein YrrB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_17 TPR_12 TPR_19 TPR_11 TPR_14 TPR_16 TPR_7 TPR_6 TPR_9 ANAPC3 TPR_15 TPR_10 TPR_21 TPR_20 TPR_MalT SNAP DUF5113 Glyco_hyd_65N_2 Ferritin_2
Motif
Other DBs
NCBI-GeneID: 938093
NCBI-ProteinID: NP_390626
Pasteur: BG13788
BSORF: BG13788
UniProt: O34452
Structure
PDB: 

Position
complement(2808707..2809327)
Genome map
AA seq 206 aa AA seqDB search
MQEGDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATA
YYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVE
LNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKAL
EMLDKAIDIQPDHMLALHAKKLIDPS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaggcgattacgagaaagcggcagaggcatttacaaaagcgattgaagaaaat
aaagaagacgcgattccgtatatcaattttgccaaccttctttcatccgtaaacgagctg
gaacgtgcgcttgcgttttatgataaagcgcttgaattagacagtagcgcagccactgct
tattatggagcaggaaatgtctatgttgtaaaagaaatgtacaaagaagcgaaagacatg
tttgaaaaagcgctacgtgcggggatggaaaacggcgacctgttttacatgctcggaacg
gtacttgtcaagctcgaacagcctaagcttgcactgccatatttacaaagagcagtcgaa
ctgaatgaaaacgatacggaagcgcgttttcaattcgggatgtgcttagccaacgagggc
atgctggacgaagcgctcagccaattcgcagctgtgacagagcaagacccggggcatgca
gatgcattttataatgccggtgtcacttatgcttataaagaaaaccgagaaaaagcgctg
gaaatgctggacaaggcaatcgatatccagccagatcatatgcttgcgcttcatgctaaa
aaactgattgatccatcataa

DBGET integrated database retrieval system