KEGG   Bacillus subtilis subsp. subtilis 168: BSU27490
Entry
BSU27490          CDS       T00010                                 

Symbol
yrrB
Name
(RefSeq) TPR repeat-containing protein YrrB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_19 TPR_12 TPR_17 TPR_11 TPR_16 TPR_14 TPR_7 TPR_6 TPR_9 ANAPC3 TPR_15 TPR_10 TPR_20 TPR_21 TPR-S TPR_MalT SNAP Glyco_hyd_65N_2
Other DBs
NCBI-GeneID: 938093
NCBI-ProteinID: NP_390626
Pasteur: BG13788
BSORF: BG13788
UniProt: O34452
Structure
Position
complement(2808707..2809327)
AA seq 206 aa
MQEGDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATA
YYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVE
LNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKAL
EMLDKAIDIQPDHMLALHAKKLIDPS
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcaggaaggcgattacgagaaagcggcagaggcatttacaaaagcgattgaagaaaat
aaagaagacgcgattccgtatatcaattttgccaaccttctttcatccgtaaacgagctg
gaacgtgcgcttgcgttttatgataaagcgcttgaattagacagtagcgcagccactgct
tattatggagcaggaaatgtctatgttgtaaaagaaatgtacaaagaagcgaaagacatg
tttgaaaaagcgctacgtgcggggatggaaaacggcgacctgttttacatgctcggaacg
gtacttgtcaagctcgaacagcctaagcttgcactgccatatttacaaagagcagtcgaa
ctgaatgaaaacgatacggaagcgcgttttcaattcgggatgtgcttagccaacgagggc
atgctggacgaagcgctcagccaattcgcagctgtgacagagcaagacccggggcatgca
gatgcattttataatgccggtgtcacttatgcttataaagaaaaccgagaaaaagcgctg
gaaatgctggacaaggcaatcgatatccagccagatcatatgcttgcgcttcatgctaaa
aaactgattgatccatcataa

DBGET integrated database retrieval system