KEGG   Bacillus subtilis subsp. subtilis 168: BSU27500
Entry
BSU27500          CDS       T00010                                 

Symbol
mnmA
Name
(RefSeq) tRNA-specific 2-thiouridylase MnmA
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU27500 (mnmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27500 (mnmA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     BSU27500 (mnmA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    BSU27500 (mnmA)
SSDB
Motif
Pfam: tRNA_Me_trans tRNA_Me_trans_C tRNA_Me_trans_M NAD_synthase Asn_synthase QueC ThiI ATP_bind_3 Cofac_haem_bdg
Other DBs
NCBI-GeneID: 938049
NCBI-ProteinID: NP_390627
Pasteur: BG13787
BSORF: BG13787
UniProt: O35020 A0A6M3ZF60
Position
complement(2809413..2810528)
AA seq 371 aa
MEKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYEDV
IRVCNQIGIPYYAVNFEKQYYEKVFQYFLDEYKAGRTPNPDVLCNKEIKFKAFLEHALSL
GADYLATGHYARVDRSGGKVRMLRGIDENKDQTYFLNQLTEDTLSKVMFPIGELQKSRVR
EIAKEAELATATKKDSTGICFIGERNFKTFLSQYLPAQPGDMMTMDGEVKGRHDGLMYYT
IGQRHGLGIGGSGEPWFAVGKDLEKNILYVDQGFHNPLLYSDKITATNISWVRSDIMKGE
EISCTAKFRYRQEDHKVTVRMTGEGEAEVIFDEQVRAVTPGQAVVFYDGEECLGGGTIDD
VYKDGTKLWYV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggaaaaacggccggaggatacaagagtcgtcgtcggcatgtccggcggagtagactca
tctgtggcggccctgctgttaaaagaacagggctatgatgtaatcggaatctttatgaaa
aactgggatgatacggacgaaaacggtttttgcacggcgacagaggattatgaagatgtg
atccgcgtctgcaaccaaatcggaattccgtattatgccgtaaactttgaaaagcaatat
tatgagaaggtatttcaatacttccttgatgaatataaagcaggcagaacaccaaacccg
gatgtattgtgcaacaaagaaattaaattcaaggcctttttggagcatgcattgtcactt
ggcgccgactatttagcgactggccactatgcaagagtagacagaagcggcggaaaagtc
agaatgctgcgcggcattgatgaaaacaaggatcaaacgtacttcctgaatcagctgaca
gaagatacgctgagcaaagtcatgttcccgatcggcgaacttcaaaaaagccgtgtgcgt
gaaattgccaaagaagcagaacttgcaacagcgacgaaaaaagacagtacaggcatctgc
tttatcggcgaacgcaacttcaaaacgtttctcagccaatatctccctgcacagccgggc
gatatgatgacgatggacggcgaagtaaaaggccgccacgacgggttgatgtactatacg
atcggacagcgtcacggccttggcatcggcggaagcggcgagccgtggtttgcggtaggc
aaagatcttgaaaagaacatcctctacgtagatcaagggttccataacccgcttttatat
tccgacaaaatcacagcaacaaatatcagctgggtacgttcggatatcatgaagggcgaa
gagatttcctgcacggctaaattccgttaccgccaagaggatcataaagtaacagtgcgc
atgactggcgaaggtgaagcggaagtcatctttgatgaacaagtccgcgctgtaacgccg
ggacaagccgttgtcttctatgacggcgaagaatgccttggcggcgggacaattgatgat
gtgtacaaagacggaacaaaattgtggtacgtataa

DBGET integrated database retrieval system