KEGG   Bacillus subtilis subsp. subtilis 168: BSU27510
Entry
BSU27510          CDS       T00010                                 

Symbol
iscS
Name
(RefSeq) cysteine desulfurase IscS 1
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU27510 (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU27510 (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27510 (iscS)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU27510 (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU27510 (iscS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BSU27510 (iscS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    BSU27510 (iscS)
 Prokaryotic type
    BSU27510 (iscS)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BSU27510 (iscS)
Prokaryotic defense system [BR:bsu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   BSU27510 (iscS)
SSDB
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2 Pyridoxal_deC
Other DBs
NCBI-GeneID: 937550
NCBI-ProteinID: NP_390629
Pasteur: BG13809
BSORF: BG13809
UniProt: O34599 A0A6M4JLH4
Position
complement(2810559..2811698)
AA seq 379 aa
MERIYLDHAATSPMDERVLEQMIPHFSGSFGNPSSIHSFGRESRKWVDEARAQIAAEIGA
AEQEIIFTSGGTEADNLAIMGTALARKDLGRHIITTKIEHHAVLHTCEKLEGDGFDITYL
DVDQNGRVSAKQVKEALRDDTILVTVMYGNNEVGTVQPIEEIGELLKEHKAYFHTDAVQA
FGLLPIDVKNSHIDLLSVSGHKLNGPKGTGFLYASKDVKLSPLLFGGEQERKRRAGTENV
PGIVGLKEAIKLSSEERDEKNEKYQSFKAIFADTLRDAGVAFEVNGDKEHSLPHVLNLYF
PGVSVEALLVNLDMAGVAVSSGSACTAGSVLPSHVLTAMFGEESDRLTSSIRISFGLGNT
AEQVKTAAKHVADVVKRLT
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggaacggatttatttagatcatgccgcaacgtctccgatggatgagcgcgtgctggaa
caaatgataccgcacttctccggcagtttcggtaatccctccagtattcattcatttggc
agagaatctcgaaaatgggtggatgaagcaagagcgcagatcgcagcagaaatcggagcg
gcagagcaggagatcatttttacaagcgggggaacggaagctgataacttggcgatcatg
ggaaccgcacttgcaagaaaagatcttggcagacatatcatcacaacaaaaattgagcat
cacgccgtgcttcacacatgtgaaaaacttgagggagacggatttgacataacgtatctg
gacgttgaccaaaatggaagagtcagtgcaaaacaggtgaaagaagcactgcgtgatgat
acaatccttgtgacagtgatgtatggaaataatgaagtcggaacagtgcagccgatcgaa
gaaatcggtgagctgttaaaggaacacaaagcttattttcataccgatgctgttcaggca
ttcgggttgctgccaattgatgtgaaaaacagccatattgaccttctgtctgtttccggg
cacaagctcaacgggccaaaagggacaggctttttatatgctagtaaagatgtgaagctt
tcaccccttttattcggaggagagcaagaaagaaaacgccgtgccggaacggaaaatgtt
ccaggcattgtcgggctgaaagaagcgatcaagctgtcaagtgaagaacgtgacgaaaaa
aacgagaagtatcaatcgtttaaagcaatctttgccgacacgcttagagatgcaggtgtg
gcattcgaggtcaacggggacaaagagcatagtctgccgcatgttctgaatctttatttc
cccggtgtgtcagtggaagcgctgctggttaatcttgatatggctggtgtcgctgtctcc
agcggttcagcgtgcacggccggttcagtcctgccgtcacatgttctgactgctatgttc
ggcgaagagagtgaccggctgacgtcctctattcgaatcagcttcggcctcggcaatacg
gctgagcaagtgaaaactgctgccaaacatgtggccgacgttgtcaaacggctgacataa

DBGET integrated database retrieval system