KEGG   Bacillus subtilis subsp. subtilis 168: BSU27520Help
Entry
BSU27520          CDS       T00010                                 

Gene name
cymR
Definition
(RefSeq) Rrf2 family transcriptional regulator
  KO
K17472  Rrf2 family transcriptional regulator, cysteine metabolism repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU27520 (cymR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   Rrf2 family
    BSU27520 (cymR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HrcA_DNA-bdg MarR_2 RuvB_C
Motif
Other DBs
NCBI-GeneID: 936456
NCBI-ProteinID: NP_390630
Pasteur: BG13813
BSORF: BG13813
UniProt: O34527
Structure
PDB: 

Position
complement(2811717..2812133)
Genome map
AA seq 138 aa AA seqDB search
MKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIRG
AYGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTTL
EDLASYTDGEQEAYMFYI
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatatcaactaagggaagatacgggctcaccattatgatcgagcttgcaaaaaag
cacggtgaaggcccgacttcattaaaaagcatcgcacagacgaataatttgtccgagcat
tatttggagcagctggtatcgccgctcagaaatgccggtttagtgaaaagcatcagaggc
gcatatggcggatatgtattaggcagtgagccggatgccattactgcgggagatattatc
cgtgtgcttgaggggccgatcagccctgttgaagtgctggaagatgaggagcctgccaag
cgtgagctctggattcgcatccgggatgctgtaaaagaggttttagacagtacaacatta
gaggatcttgccagctatacagacggagagcaagaagcttatatgttctatatttag

DBGET integrated database retrieval system