KEGG   Bacillus subtilis subsp. subtilis 168: BSU27520
Entry
BSU27520          CDS       T00010                                 

Symbol
cymR
Name
(RefSeq) Rrf2 family transcriptional regulator
  KO
K17472  Rrf2 family transcriptional regulator, cysteine metabolism repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU27520 (cymR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Rrf2 family
    BSU27520 (cymR)
SSDB
Motif
Pfam: Rrf2 HrcA_DNA-bdg RuvB_C
Other DBs
NCBI-GeneID: 936456
NCBI-ProteinID: NP_390630
Pasteur: BG13813
BSORF: BG13813
UniProt: O34527 A0A6M3ZIS9
Structure
Position
complement(2811717..2812133)
AA seq 138 aa
MKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIRG
AYGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTTL
EDLASYTDGEQEAYMFYI
NT seq 417 nt   +upstreamnt  +downstreamnt
ttgaaaatatcaactaagggaagatacgggctcaccattatgatcgagcttgcaaaaaag
cacggtgaaggcccgacttcattaaaaagcatcgcacagacgaataatttgtccgagcat
tatttggagcagctggtatcgccgctcagaaatgccggtttagtgaaaagcatcagaggc
gcatatggcggatatgtattaggcagtgagccggatgccattactgcgggagatattatc
cgtgtgcttgaggggccgatcagccctgttgaagtgctggaagatgaggagcctgccaag
cgtgagctctggattcgcatccgggatgctgtaaaagaggttttagacagtacaacatta
gaggatcttgccagctatacagacggagagcaagaagcttatatgttctatatttag

DBGET integrated database retrieval system