KEGG   Bacillus subtilis subsp. subtilis 168: BSU27540Help
Entry
BSU27540          CDS       T00010                                 

Gene name
yrvM
Definition
(RefSeq) hypothetical protein
  KO
K22132  tRNA threonylcarbamoyladenosine dehydratase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27540 (yrvM)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU27540 (yrvM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Sacchrp_dh_NADP 2-Hacid_dh_C UDPG_MGDP_dh_N ApbA TrkA_N 3HCDH_N Shikimate_DH ELFV_dehydrog FAD_binding_3 DAO ETF
Motif
Other DBs
NCBI-GeneID: 938590
NCBI-ProteinID: NP_390632
Pasteur: BG13807
BSORF: BG13807
UniProt: O32037
Position
complement(2813643..2814407)
Genome map
AA seq 254 aa AA seqDB search
MLHQFSRNELAIGKEGLETLKNSTVAVLGVGGVGSFAAEALARSGVGRILLVDKDDVDIT
NVNRQLHALLSTVGQPKVDLMKARIADINPECEVIALKMFYTEETYEQFFDYGLDYVIDA
SDTICYKIHLMKECLKRDIPLISSMGAANKTDPTRFQIADISKTHTDPIAKVVRTKLRKE
GIKKGVQVIFSDESPIVIREDVRKEVGNDEAKIRKAKMPPSSNAFVPSVAGLIMGGHVVM
DLLKDIEIKRVKDK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgttacaccagttttcacgcaatgaattagctatcggaaaagaaggccttgaaacgctg
aaaaacagcacagttgctgtgcttggagtcgggggagtcgggtcgttcgcggcggaagct
ctcgcgcggtcaggcgtcggccgcattctgcttgtcgacaaagatgatgtcgacattaca
aatgtaaatcgtcagcttcacgcgctgctttcaactgtcggacagccgaaagttgattta
atgaaggcgcggatcgcagacattaacccggagtgtgaagtgatcgcgttaaaaatgttc
tatacggaggaaacgtatgagcagttttttgactatggtcttgactatgtcattgatgcg
tcagacaccatttgttataaaattcatttaatgaaagaatgtctaaaacgggatattccg
ctcatctccagcatgggtgctgcaaataaaacggatccgacacgcttccaaatcgctgat
atctcaaaaacgcacactgatccaattgcgaaggtcgttcgtacgaaattacgcaaggag
ggtatcaaaaaaggcgttcaagtgattttctctgatgaaagcccgattgttattcgggaa
gatgtcagaaaagaagtggggaatgacgaagcgaaaatacgtaaagcaaaaatgccgcct
tcctctaatgcttttgtgccgtcagttgcaggtttgattatgggcggacatgttgtcatg
gatcttttgaaagacattgaaatcaaacgtgtgaaggataaataa

DBGET integrated database retrieval system