KEGG   Bacillus subtilis subsp. subtilis 168: BSU27550Help
Entry
BSU27550          CDS       T00010                                 

Gene name
aspS
Definition
(RefSeq) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Module
bsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU27550 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU27550 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27550 (aspS)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU27550 (aspS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BSU27550 (aspS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BSU27550 (aspS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSU27550 (aspS)
 Prokaryotic Type
   Other AARSs
    BSU27550 (aspS)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU27550 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 937549
NCBI-ProteinID: NP_390633
Pasteur: BG12572
BSORF: BG12572
UniProt: O32038
Position
complement(2814743..2816521)
Genome map
AA seq 592 aa AA seqDB search
MFGRTYYCGDITEKAIGESVTLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPDVSKEAL
AIAEGIRNEYVLDIQGKVVAREEGTVNPNLKTGAIEIHADGVNVLNAAKTPPFAISDQAE
EVSEDVRLKHRYLDLRRPAMFQTMQLRHNVTKAVRSFLDENGFLDIETPILTGSTPEGAR
DYLVPSRVHEGEFYALPQSPQLFKQLLMVSGIERYYQIARCFRDEDLRADRQPEFTQIDI
EMSFMSQEDIMSLAEEMMAKVMRETKGEELQLPLPRMTYDEAMNKYGSDKPDTRFDMLLT
DVSDIVKDTEFKVFSSAVANGGVVKAINVKGGAGDYSRKDIDALGAFAANYGAKGLAWVK
VEADGVKGPIAKFFDEEKQSKLIEALDAAEGDLLLFGADQFEVVAASLGALRLKLGKERG
LIDEKLFNFLWVIDWPLLEHDPEEGRFYAAHHPFTMPVREDLELIETAPEDMKAQAYDLV
LNGYELGGGSIRIFEKDIQEKMFALLGFSPEEAAEQFGFLLEAFEYGAPPHGGIALGLDR
LVMLLAGRTNLRDTIAFPKTASASCLMTEAPGEVSDAQLDELHLSIKKKVKN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggaagaacatattattgcggtgatataactgaaaaagcaattggcgaatctgta
acgctgaaaggctgggtccaaaaaagacgagacctcggcggattgatttttattgacttg
cgtgaccgtacgggcattgttcaagtcgtttttaaccctgatgtgtcaaaagaagcgctt
gctattgcggaaggcatcagaaatgaatacgtgcttgatattcaaggaaaagtggtggcg
cgtgaagagggaacagttaatccgaatttgaaaacaggcgcgatcgaaatacatgctgat
ggagtgaacgtattaaatgctgcaaagacacctccatttgcgatttctgatcaagctgaa
gaagtgtcagaggacgttcgtttaaaacaccgttacttagatttgcgcagaccggctatg
ttccagacgatgcagctgcgccataacgtgacgaaagctgttcgcagctttttagatgaa
aatgggtttcttgatattgaaacgccgattttaacaggaagcacgcctgaaggcgcacgt
gactacttggtgccgagccgtgtgcacgaaggtgagttctacgcgctgccgcagtctccg
cagctatttaaacagcttctgatggtatcaggcattgaacgatattatcaaattgcccgc
tgtttccgcgatgaagacttgcgtgcggaccgtcagcctgagtttacgcaaattgatatt
gaaatgtcctttatgagccaggaagacattatgtcattggctgaggagatgatggcaaag
gttatgcgtgaaacaaaaggtgaggaacttcagcttcctcttcctcgaatgacgtatgac
gaagcaatgaacaagtacgggtctgataaaccggatacgcgttttgacatgcttttgacg
gatgtgtctgacattgtaaaggatacggaatttaaagtgttctcatcagctgtagcaaac
ggcggcgtggtcaaagccatcaatgtaaaaggcggtgccggcgattactccagaaaagac
atcgacgctcttggcgcttttgctgcaaactacggggcaaaagggcttgcctgggtgaag
gttgaggcagacggagtgaaaggcccgatcgctaaattctttgatgaagaaaagcagtct
aagctgattgaagcacttgatgctgctgaaggtgatttgctgctgttcggagcggatcaa
ttcgaagttgtggccgcatcactcggcgccctgcgcttaaagcttgggaaagaacgcgga
ctgattgacgaaaaattgttcaatttcttatgggtcatcgactggccgctattagagcat
gatccggaagaaggccgtttttacgcagcgcaccatccgttcacaatgcctgtccgagaa
gaccttgagctgattgaaacagcgcctgaagacatgaaagcgcaagcttatgacctcgtc
ttaaacggctatgagcttggcggcggttcaatccgtattttcgaaaaggatattcaggaa
aaaatgtttgcgcttctcggcttctcaccagaagaagcggctgaacagttcggattcctg
ctggaagcatttgaatacggcgctcctccgcacggcggaatcgcactcggcttagaccgt
ctcgttatgcttctcgctggacgtacgaacctgagagatacgattgcattcccgaaaacg
gcaagtgcaagctgcctgatgacagaagcgccaggcgaagtaagcgacgcccagcttgac
gagcttcatctttctatcaagaaaaaagttaagaactga

DBGET integrated database retrieval system