KEGG   Bacillus subtilis subsp. subtilis 168: BSU27560Help
Entry
BSU27560          CDS       T00010                                 

Gene name
hisS
Definition
(RefSeq) histidine--tRNA ligase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Module
bsu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU27560 (hisS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU27560 (hisS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27560 (hisS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     BSU27560 (hisS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BSU27560 (hisS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BSU27560 (hisS)
 Prokaryotic Type
    BSU27560 (hisS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His HGTP_anticodon tRNA-synt_2b HGTP_anticodon2 tRNA-synt_2d tRNA-synt_2
Motif
Other DBs
NCBI-GeneID: 938617
NCBI-ProteinID: NP_390634
Pasteur: BG12605
BSORF: BG12605
UniProt: O32039
Position
complement(2816535..2817809)
Genome map
AA seq 424 aa AA seqDB search
MGYNIPRGTQDILPGESDRWQFVEQIMRDTCRTYQYKEIRTPIFEHTELFARGVGESTDI
VQKEMYTFEDRKGRSLTLRPEGTAAAVRAFNENKLFANPVQPTKLYYVGPMFRYERPQTG
RYRQFYQFGIEAIGSKDPAIDAEVMALAMSIYEKAGLENVKLVINSLGDQDSRKSYREAL
VKHFEPRIEEFCSDCQSRLHTNPLRILDCKKDRDHELMKSAPSILTYLNEESAAYFEKVK
QYLNDLGISYEIDPNLVRGLDYYNHTAFEIMSNAEGFGAITTLAGGGRYDGLVEQIGGPE
APGIGFAMSIERLLAAIDAEKRELPVDKGIDCYIVTLGEKAKDYSVSLVYKLREAGISSE
IDYENKKMKGQFKTADRLKARFIAILGEDELAQNKINVKDAQTGEQIEVALDEFIHVMKA
NQKG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggatataacattccgagaggaacacaggatattctgcctggagaatcagatcgctgg
cagtttgttgaacaaattatgagagacacttgccgcacttatcaatataaagaaatccgc
acaccgatttttgagcatacagaactgtttgccagaggcgtcggagaatcaacggatatc
gtacaaaaagaaatgtataccttcgaggaccgcaaaggcagaagcctgacgcttcgtccg
gagggaacagctgctgcggttcgcgcttttaatgaaaacaagctgttcgcaaatcctgta
cagccgacaaagctttattatgtcgggccgatgttccgttatgaacgtcctcagacgggc
cgttaccgccagttttatcagtttggaattgaagcgattggttcgaaagaccctgcaatc
gacgctgaagtaatggcgcttgcgatgagtatttatgaaaaagcaggtttagaaaacgtt
aagcttgtcataaacagtctcggcgatcaagatagccgcaaaagctacagagaagcgctc
gtgaaacacttcgagcctcgcatcgaagaattttgttcagactgccagtcccggctgcac
acgaacccgcttagaattttggactgcaaaaaagaccgtgatcatgagctgatgaaatcg
gcaccttcgattttgacatatttaaatgaagaatcagccgcttattttgaaaaagtgaaa
caatacttaaatgatcttggcatttcgtatgaaatcgatccgaaccttgtgagagggctg
gattattacaaccacaccgcatttgaaattatgagcaatgcggagggctttggcgcgatt
acgacacttgccggcggcggacgctacgacgggcttgtcgaacagatcggcggacctgaa
gcaccgggcatcggatttgcgatgagcatcgaacgcttgcttgccgcaattgatgctgaa
aaaagagagctgcctgttgataagggaatcgactgctatatcgtcacactcggcgaaaaa
gcaaaggattattctgtttcattggtgtacaaactgagagaagcaggcatttccagtgaa
atcgattatgaaaataagaaaatgaaaggccagtttaaaacagctgatcgcttaaaggcc
agatttattgcgattttgggtgaagatgagcttgcccaaaacaaaatcaatgtaaaggat
gcacagacgggcgaacagattgaagtggcacttgatgaatttatacatgtgatgaaggca
aaccaaaagggataa

DBGET integrated database retrieval system