KEGG   Bacillus subtilis subsp. subtilis 168: BSU27570
Entry
BSU27570          CDS       T00010                                 

Symbol
yrzK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YrzK
Other DBs
NCBI-GeneID: 936478
NCBI-ProteinID: NP_390635
Pasteur: BG13820
BSORF: BG13820
UniProt: O32040 A0A6M4JKG6
Position
complement(2818191..2818361)
AA seq 56 aa
MKYHPKMGRAFHDGEANLHYSDHADPDTTGYLTETASEFGLMSKEAALRKNNRNKA
NT seq 171 nt   +upstreamnt  +downstreamnt
atgaaatatcatccaaaaatgggacgtgcatttcacgacggtgaagcgaatctgcattac
agcgatcacgcagatcccgatacgactggttatcttacggaaacagcatctgaatttggt
cttatgtccaaagaagcagcgctgaggaaaaacaaccggaataaagcttga

DBGET integrated database retrieval system