KEGG   Bacillus subtilis subsp. subtilis 168: BSU27570Help
Entry
BSU27570          CDS       T00010                                 

Gene name
yrzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YrzK
Motif
Other DBs
NCBI-GeneID: 936478
NCBI-ProteinID: NP_390635
Pasteur: BG13820
BSORF: BG13820
UniProt: O32040
Position
complement(2818191..2818361)
Genome map
AA seq 56 aa AA seqDB search
MKYHPKMGRAFHDGEANLHYSDHADPDTTGYLTETASEFGLMSKEAALRKNNRNKA
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcatccaaaaatgggacgtgcatttcacgacggtgaagcgaatctgcattac
agcgatcacgcagatcccgatacgactggttatcttacggaaacagcatctgaatttggt
cttatgtccaaagaagcagcgctgaggaaaaacaaccggaataaagcttga

DBGET integrated database retrieval system