KEGG   Bacillus subtilis subsp. subtilis 168: BSU27590Help
Entry
BSU27590          CDS       T00010                                 

Gene name
yrvI
Definition
(RefSeq) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27590 (yrvI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     BSU27590 (yrvI)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    BSU27590 (yrvI)
 Prokaryotic Type
    BSU27590 (yrvI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase DUF432 Phosphatase
Motif
Other DBs
NCBI-GeneID: 936530
NCBI-ProteinID: NP_390637
Pasteur: BG13805
BSORF: BG13805
UniProt: O32042
Position
complement(2820077..2820475)
Genome map
AA seq 132 aa AA seqDB search
MDEEVVGQIGQGLMVLVGITHDDTEDDAAYLADKVVNLRIFDDSEGKMNLSLVDIGGEIL
SVSQFTLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLREKGIKVETGTFGAMMDVQLT
NSGPVTLIMDSK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaagaggtcgtcggccaaattggacaaggccttatggtgctggtcggcatcact
cacgatgatacagaagatgatgcagcttatttagccgataaagttgtcaatctccgtatt
ttcgatgacagtgaagggaaaatgaatctgtctcttgtagatataggaggagagatttta
tccgtctcacagtttacgctttatggagatacgaaaaaagggcgccggccgaactacatg
aacgcggccaaacctgataaagctttaggtctttatgaaaaatggaatgacctgcttcgt
gaaaaaggaatcaaagtggagaccggaacgtttggagcaatgatggatgttcagcttaca
aactccggaccggtcacgctcattatggattcaaaataa

DBGET integrated database retrieval system