KEGG   Bacillus subtilis subsp. subtilis 168: BSU27600
Entry
BSU27600          CDS       T00010                                 

Gene name
relA
Definition
(RefSeq) GTP pyrophosphokinase
  KO
K01139  GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU27600 (relA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU27600 (relA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     BSU27600 (relA)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     BSU27600 (relA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU27600 (relA)
SSDB
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 DUF5913 HD ACT ThiS DNA_pol3_gamma3 RsgI_N
Other DBs
NCBI-GeneID: 936753
NCBI-ProteinID: NP_390638
Pasteur: BG12665
BSORF: BG12665
UniProt: O54408 A0A6M3ZJM5
Position
complement(2820529..2822733)
AA seq 734 aa
MANEQVLTAEQVIDKARSYLSDEHIAFVEKAYLYAEDAHREQYRKSGEPYIIHPIQVAGI
LVDLEMDPSTIAGGFLHDVVEDTDVTLDDLKEAFSEEVAMLVDGVTKLGKIKYKSQEEQQ
AENHRKMFVAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGI
SKIKWELEDTALRYLNPQQYYRIVNLMKKKRAERELYVDEVVNEVKKRVEEVNIKADFSG
RPKHIYSIYRKMVLQNKQFNEIYDLLAVRILVNSIKDCYAVLGIIHTCWKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGDPLEVQIRTFEMHEIAEYGVAAHWAYKEGKAANEGATFEK
KLSWFREILEFQNESTDAEEFMESLKIDLFSDMVYVFTPKGDVIELPSGSVPIDFSYRIH
SEIGNKTIGAKVNGKMVTLDHKLRTGDIVEILTSKHSYGPSQDWVKLAQTSQAKHKIRQF
FKKQRREENVEKGRELVEKEIKNLDFELKDVLTPENIQKVADKFNFSNEEDMYAAVGYNG
ITALQVANRLTEKERKQRDQEEQEKIVQEVTGEPKPYPQGRKREAGVRVKGIDNLLVRLS
KCCNPVPGDDIVGFITKGRGVSVHREDCPNVKTNEAQERLIPVEWEHESQVQKRKEYNVE
IEILGYDRRGLLNEVLQAVNETKTNISSVSGKSDRNKVATIHMAIFIQNINHLHKVVERI
KQIRDIYSVRRVMN
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcgaacgaacaagtattgactgccgagcaagttatagataaagcacgcagctatcta
tctgatgagcatatcgcatttgtcgaaaaagcatatctgtacgctgaagatgctcatcgc
gagcaataccgcaaatcgggcgagccatatattattcatccgattcaggttgcggggata
ctcgttgatcttgaaatggacccttccacaatcgcgggcggatttttgcacgatgtcgtg
gaagatacagatgtgacgctcgatgacctgaaagaagcattttccgaagaagtggcaatg
cttgtagacggcgtaacgaaactcggcaaaattaaatataaatctcaagaggaacagcag
gcggaaaatcatcgcaaaatgtttgtcgctatggctcaagatatcagggtcatattgatc
aagctggcggatcgtcttcacaatatgcggacactgaaacatctgcctcaggaaaaacag
cggagaatctccaatgaaacgctggaaatttttgctcctttggcgcatcgtctcgggatt
tcaaaaattaagtgggaattggaagatacggcgctccgttatttgaaccctcagcaatat
tacagaattgtcaacctcatgaagaagaaacgtgcagaacgagagctttatgtcgatgag
gttgtcaatgaagtgaagaaacgtgtcgaagaagtaaatatcaaggctgacttctcggga
cgcccgaaacatatttacagcatttatcgaaaaatggtgctgcaaaataagcaattcaat
gaaatttacgatttgttggctgtccgtattcttgtgaatagcataaaggactgctacgcg
gtgcttggcatcattcacacatgctggaaaccgatgccaggcagattcaaagattatatc
gcaatgccgaagccgaatatgtatcaatcgcttcatacaacggttattgggcctaaaggc
gatccgcttgaagtgcagatccgcacctttgaaatgcatgaaatagcggaatacggggtt
gcggctcactgggcttataaagaagggaaagcagccaatgaaggtgcaacctttgagaaa
aagctttcttggttccgtgaaattttagaatttcaaaatgaatcgacagatgcagaagaa
tttatggaatcgctcaaaattgatttgttctctgacatggtgtatgtctttacgccaaaa
ggagatgtaatcgagcttccgtccggttctgttccgattgacttttcttaccggattcac
tctgaaatcggcaataaaacaatcggtgccaaagtaaacggaaaaatggttacgcttgac
cataagcttcggacaggtgatatcgttgaaattctcacctctaagcattcctacggtccg
agccaggattgggtgaagcttgcccaaacatcccaagcgaagcataaaatccgtcaattc
tttaagaaacagcggcgtgaagaaaatgtcgaaaaaggccgtgagctggtcgaaaaagaa
attaaaaacttggattttgaattgaaggatgttttaacgccggagaatattcaaaaggtt
gctgacaaatttaatttctcaaatgaagaggatatgtacgcggcggtcggttacaacggc
atcacagctctgcaggtggcgaaccgcctaacagaaaaagagagaaagcagcgcgaccag
gaagaacaggaaaagatcgttcaggaagtcactggggaacctaagccatacccgcaagga
agaaaacgggaagctggcgttcgtgtcaagggcattgacaacctccttgtccgtttatca
aaatgctgcaatcctgtgccaggtgatgatattgtcggctttatcacaaaaggcagaggg
gtttcggtccatcgcgaagactgtccgaatgtcaaaacgaatgaagcccaagagcggctg
atcccggtagagtgggaacatgagtcacaagttcaaaagcgcaaggaatacaatgttgag
atagagattcttgggtatgaccgccgcggattgctgaacgaggtactccaggcagtgaat
gaaacgaaaaccaatatttcatctgtctctggcaaatcggatcgcaataaagtggcaacc
atccatatggcgatttttatccagaatatcaatcacttgcataaagtcgtcgagcgtatt
aaacagattagagatatctattctgtgcgccgcgtcatgaactaa

DBGET integrated database retrieval system