KEGG   Bacillus subtilis subsp. subtilis 168: BSU27600Help
Entry
BSU27600          CDS       T00010                                 

Gene name
relA
Definition
(RefSeq) GTP pyrophosphokinase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU27600 (relA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     BSU27600 (relA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT DNA_pol3_gamma3 ThiS Ub-Mut7C RsgI_N
Motif
Other DBs
NCBI-GeneID: 936753
NCBI-ProteinID: NP_390638
Pasteur: BG12665
BSORF: BG12665
UniProt: O54408
Position
complement(2820529..2822733)
Genome map
AA seq 734 aa AA seqDB search
MANEQVLTAEQVIDKARSYLSDEHIAFVEKAYLYAEDAHREQYRKSGEPYIIHPIQVAGI
LVDLEMDPSTIAGGFLHDVVEDTDVTLDDLKEAFSEEVAMLVDGVTKLGKIKYKSQEEQQ
AENHRKMFVAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGI
SKIKWELEDTALRYLNPQQYYRIVNLMKKKRAERELYVDEVVNEVKKRVEEVNIKADFSG
RPKHIYSIYRKMVLQNKQFNEIYDLLAVRILVNSIKDCYAVLGIIHTCWKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGDPLEVQIRTFEMHEIAEYGVAAHWAYKEGKAANEGATFEK
KLSWFREILEFQNESTDAEEFMESLKIDLFSDMVYVFTPKGDVIELPSGSVPIDFSYRIH
SEIGNKTIGAKVNGKMVTLDHKLRTGDIVEILTSKHSYGPSQDWVKLAQTSQAKHKIRQF
FKKQRREENVEKGRELVEKEIKNLDFELKDVLTPENIQKVADKFNFSNEEDMYAAVGYNG
ITALQVANRLTEKERKQRDQEEQEKIVQEVTGEPKPYPQGRKREAGVRVKGIDNLLVRLS
KCCNPVPGDDIVGFITKGRGVSVHREDCPNVKTNEAQERLIPVEWEHESQVQKRKEYNVE
IEILGYDRRGLLNEVLQAVNETKTNISSVSGKSDRNKVATIHMAIFIQNINHLHKVVERI
KQIRDIYSVRRVMN
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaacaagtattgactgccgagcaagttatagataaagcacgcagctatcta
tctgatgagcatatcgcatttgtcgaaaaagcatatctgtacgctgaagatgctcatcgc
gagcaataccgcaaatcgggcgagccatatattattcatccgattcaggttgcggggata
ctcgttgatcttgaaatggacccttccacaatcgcgggcggatttttgcacgatgtcgtg
gaagatacagatgtgacgctcgatgacctgaaagaagcattttccgaagaagtggcaatg
cttgtagacggcgtaacgaaactcggcaaaattaaatataaatctcaagaggaacagcag
gcggaaaatcatcgcaaaatgtttgtcgctatggctcaagatatcagggtcatattgatc
aagctggcggatcgtcttcacaatatgcggacactgaaacatctgcctcaggaaaaacag
cggagaatctccaatgaaacgctggaaatttttgctcctttggcgcatcgtctcgggatt
tcaaaaattaagtgggaattggaagatacggcgctccgttatttgaaccctcagcaatat
tacagaattgtcaacctcatgaagaagaaacgtgcagaacgagagctttatgtcgatgag
gttgtcaatgaagtgaagaaacgtgtcgaagaagtaaatatcaaggctgacttctcggga
cgcccgaaacatatttacagcatttatcgaaaaatggtgctgcaaaataagcaattcaat
gaaatttacgatttgttggctgtccgtattcttgtgaatagcataaaggactgctacgcg
gtgcttggcatcattcacacatgctggaaaccgatgccaggcagattcaaagattatatc
gcaatgccgaagccgaatatgtatcaatcgcttcatacaacggttattgggcctaaaggc
gatccgcttgaagtgcagatccgcacctttgaaatgcatgaaatagcggaatacggggtt
gcggctcactgggcttataaagaagggaaagcagccaatgaaggtgcaacctttgagaaa
aagctttcttggttccgtgaaattttagaatttcaaaatgaatcgacagatgcagaagaa
tttatggaatcgctcaaaattgatttgttctctgacatggtgtatgtctttacgccaaaa
ggagatgtaatcgagcttccgtccggttctgttccgattgacttttcttaccggattcac
tctgaaatcggcaataaaacaatcggtgccaaagtaaacggaaaaatggttacgcttgac
cataagcttcggacaggtgatatcgttgaaattctcacctctaagcattcctacggtccg
agccaggattgggtgaagcttgcccaaacatcccaagcgaagcataaaatccgtcaattc
tttaagaaacagcggcgtgaagaaaatgtcgaaaaaggccgtgagctggtcgaaaaagaa
attaaaaacttggattttgaattgaaggatgttttaacgccggagaatattcaaaaggtt
gctgacaaatttaatttctcaaatgaagaggatatgtacgcggcggtcggttacaacggc
atcacagctctgcaggtggcgaaccgcctaacagaaaaagagagaaagcagcgcgaccag
gaagaacaggaaaagatcgttcaggaagtcactggggaacctaagccatacccgcaagga
agaaaacgggaagctggcgttcgtgtcaagggcattgacaacctccttgtccgtttatca
aaatgctgcaatcctgtgccaggtgatgatattgtcggctttatcacaaaaggcagaggg
gtttcggtccatcgcgaagactgtccgaatgtcaaaacgaatgaagcccaagagcggctg
atcccggtagagtgggaacatgagtcacaagttcaaaagcgcaaggaatacaatgttgag
atagagattcttgggtatgaccgccgcggattgctgaacgaggtactccaggcagtgaat
gaaacgaaaaccaatatttcatctgtctctggcaaatcggatcgcaataaagtggcaacc
atccatatggcgatttttatccagaatatcaatcacttgcataaagtcgtcgagcgtatt
aaacagattagagatatctattctgtgcgccgcgtcatgaactaa

DBGET integrated database retrieval system