KEGG   Bacillus subtilis subsp. subtilis 168: BSU27610Help
Entry
BSU27610          CDS       T00010                                 

Gene name
apt
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU27610 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU27610 (apt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     BSU27610 (apt)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU27610 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 938063
NCBI-ProteinID: NP_390639
Pasteur: BG12568
BSORF: BG12568
UniProt: O34443
Position
complement(2822901..2823413)
Genome map
AA seq 170 aa AA seqDB search
MDLKQYVTIVPDYPKEGVQFKDITTLMDKGDVYRYATDQIVEYAKEKQIDLVVGPEARGF
IIGCPVAYALGVGFAPVRKEGKLPREVIKVDYGLEYGKDVLTIHKDAIKPGQRVLITDDL
LATGGTIEATIKLVEELGGVVAGIAFLIELSYLDGRNKLEDYDILTLMKY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaacaatacgtaacaattgtaccggattacccgaaagagggcgtgcaattt
aaagatattacgacactgatggataaaggcgatgtataccgctatgccacagatcaaatt
gttgaatatgcgaaagaaaagcaaattgatttggtcgttggccctgaagcgcgcggcttt
attatcggctgtcccgttgcttacgcgcttggcgtaggttttgcgccggtccgcaaagaa
ggcaagttgcctcgtgaagtaatcaaagtggattatggcttggaatacggaaaagacgta
ttaacgatccacaaagatgcgattaagcctggtcagcgtgtgcttattacagatgacctg
cttgcgacaggcggcacaattgaagcgacaatcaaacttgttgaagaacttggcggcgtt
gttgctggtatcgctttcttaatcgagctttcttaccttgacggcagaaataagctcgaa
gattacgacatcttaacattgatgaaatactaa

DBGET integrated database retrieval system