KEGG   Bacillus subtilis subsp. subtilis 168: BSU27620Help
Entry
BSU27620          CDS       T00010                                 

Gene name
recJ
Definition
(RefSeq) single-stranded-dna-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03410  Base excision repair
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BSU27620 (recJ)
   03430 Mismatch repair
    BSU27620 (recJ)
   03440 Homologous recombination
    BSU27620 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU27620 (recJ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU27620 (recJ)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     BSU27620 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU27620 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BSU27620 (recJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH tRNA_anti-codon PGM_PMM_II
Motif
Other DBs
NCBI-GeneID: 937538
NCBI-ProteinID: NP_390640
Pasteur: BG13804
BSORF: BG13804
UniProt: O32044
Position
complement(2823419..2825779)
Genome map
AA seq 786 aa AA seqDB search
MLASKMRWEIQRPDQDKVKSLTEQLHITPLVASLLVKRGFDTAESARLFLHTKDADFYDP
FEMKGMKEAADRIKQAISQQEKIMIYGDYDADGVTSTSVMLHTLQKLSAQVDFYIPDRFK
EGYGPNEQAFRSIKERGFSLIITVDTGIAAVHEAKVAKELGLDVIITDHHEPGPELPDVR
AIVHPKQPGCTYPFKELAGVGVAFKLAHALLGELPDELLDLAAIGTIADLVPLHDENRLI
ATLGLERLRRTNRLGLKELIKLSGGDIGEANEETVGFQLAPRLNAVGRIEQADPAVHLLM
SEDSFEAEELAAEIDQLNKERQKMVSKMTDEAIEMVEQQGLDQTAIVVAKAGWNPGVVGI
VASKLVDRFYRPAIVLGIDEEKGIAKGSARSIRGFNLFESLSECRDILPHFGGHPMAAGM
TLKAEDVPDLRSRLNEIADNTLTEEDFIPVQEVDLVCGVEDITVESIAEMNMLSPFGMLN
PKPHVLVENAVLEDVRKIGANKTHVKMTIRNESSQLDCVGFNKGELQEGIVPGSRISIVG
EMSINEWNNRKKPQLMIKDAAVSEWQLFDLRGKRTWEDTVSALPSAKRAIVSFKEDSTTL
LQTEDLRREVHVISSKDQAKAFDLDGAYIVLLDPPPSLDMLARLLEGKAPERIYFIFLNH
EDHFLSTFPARDHFKWYYAFLLKRGAFDVKKHGSELAKHKGWSVETINFMTKVFFDLGFV
KIENGVLSVVSGAKKRDLTDSQTYQAKQQLMELDQKLNYSSAEELKEWLNKLMKQDSEAY
ESTRRT
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgtcaaaaatgcgatgggaaatccagcgaccagatcaggataaggtcaaatca
ctcacagaacaattgcatataacacctcttgttgcgtccctgcttgtaaaaagaggcttt
gatacggcagaaagcgctaggctgtttttacatacaaaggatgccgatttttatgatcct
tttgaaatgaaaggcatgaaagaagcggcagatcgaataaaacaggcgatttcacaacaa
gaaaagattatgatatatggcgattatgacgccgatggggttacaagtacgtcagtgatg
cttcacacgctgcaaaaactgtcggctcaagttgatttttatatacctgaccgttttaaa
gaaggatatggacctaatgaacaggcgtttcgttcgattaaagaacggggcttctctttg
atcattacggttgatacaggaattgccgctgtgcatgaagcgaaggtggcaaaggaactc
ggactggatgtcatcattaccgatcatcatgaaccgggaccggagcttccggatgtccgt
gcgatcgtccacccgaagcagcctggctgcacttacccgtttaaagagcttgccggggtt
ggagtcgcgtttaagcttgcccacgctttattgggtgaacttcctgatgaactgcttgac
ctggcggctatcggcaccattgccgatctagtcccgctgcatgacgaaaacagattaata
gcaacactaggacttgaaaggcttcgacggacaaatcggctcggcttaaaagagctgatt
aagctgtcaggcggagacatcggagaagcgaacgaagaaacagtcggatttcagctcgca
ccaaggctgaatgccgtcggaagaatcgaacaggcggatcccgctgttcatttgcttatg
tcagaggattcgtttgaagcggaagagcttgccgcagaaattgaccagctgaacaaagag
cgccaaaaaatggtcagcaaaatgacggatgaagcgattgaaatggttgaacagcaaggg
ctcgatcaaactgcaattgtcgtggccaaagccggatggaacccgggagtcgtcgggatt
gtggcttcaaagcttgtggaccgtttctaccgaccggccattgttcttggtattgatgaa
gaaaagggaatcgctaaaggttcggcccgaagcatcagaggatttaatttatttgagagc
ctttctgaatgcagagatattcttcctcatttcggcggccatccaatggctgcggggatg
acgctgaaagccgaagatgtgccggatttgcgaagcaggctgaatgaaatagcggacaat
acgcttacggaagaggattttattcccgtacaggaagtcgaccttgtctgcggcgtcgaa
gacattacagttgaaagcatcgcagaaatgaacatgctgtctccttttggcatgctgaac
ccgaaaccgcacgttctcgtagaaaatgcagtactggaagatgtccgcaagataggggca
aataaaactcatgtcaaaatgacgatcagaaacgagtcgtcccagcttgattgcgtcggt
tttaataaaggcgagcttcaagaaggcatcgtaccgggttcaagaatttccattgtcggt
gagatgtcaatcaacgaatggaacaatcgaaaaaagccgcagcttatgataaaggatgcc
gctgtttctgaatggcagctgtttgatttaaggggaaaacggacgtgggaagacacagtt
tccgcccttccatctgctaaacgggccattgtctctttcaaagaagactcaacaacatta
cttcaaactgaagaccttcgccgagaagtgcacgtcatcagttctaaagatcaagcaaag
gcgtttgacctcgatggtgcatatattgtattactggatccgccgccttcgctggacatg
ctcgcacgtttgctggaaggaaaggcgcccgagcggatatattttatttttctcaatcat
gaggaccactttttatcaacttttcccgcaagagaccactttaaatggtattatgcgttc
ttgctgaaaagaggcgcttttgacgtgaaaaaacacggttcagagcttgcaaaacataaa
ggctggtccgttgaaacaatcaatttcatgacaaaggtgttttttgatctcggttttgtt
aaaatagagaatggtgtgctgtctgttgtgagcggagcaaagaaacgcgacttaacagac
tcacaaacatatcaggcgaaacagcagctgatggaactggatcaaaagctgaattattct
tctgctgaagagctgaaggaatggctgaataagctgatgaaacaagattcagaggcttat
gaaagtacgaggaggacataa

DBGET integrated database retrieval system