KEGG   Bacillus subtilis subsp. subtilis 168: BSU27630Help
Entry
BSU27630          CDS       T00010                                 

Gene name
yrvD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LapA_dom DUF2254 Cation_ATPase_C Tmemb_161AB Ly49 UPF0542 DivIC Wzy_C Claudin_3 Lectin_N DUF2207 CbtB
Motif
Other DBs
NCBI-GeneID: 937537
NCBI-ProteinID: NP_390641
Pasteur: BG13803
BSORF: BG13803
UniProt: O32045
Position
complement(2825846..2826169)
Genome map
AA seq 107 aa AA seqDB search
MNKQWTIIFALIFTLIVAIFAVINVRSVEVDYLFGRSEWPLILVILGSVLMGALIVFSVG
IFQVMKLKREIKTLRKENRTAIHKQEDTHLADQTDTQDASAMIEKKD
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaatggaccattattttcgcacttattttcaccttaattgtcgctattttc
gcagtcattaatgttcgatccgtagaagttgattacctgtttggaagatcagaatggccg
ctcattcttgttattttgggctcagttttaatgggagcactgatcgtattttctgtcggc
atttttcaggtaatgaaattgaagcgggaaataaaaaccttgcggaaagaaaatagaaca
gcaatacataaacaagaggatactcatcttgctgatcagactgacacacaggatgcatca
gccatgattgagaaaaaagactag

DBGET integrated database retrieval system