KEGG   Bacillus subtilis subsp. subtilis 168: BSU27640Help
Entry
BSU27640          CDS       T00010                                 

Gene name
yrvC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C Castor_Poll_mid
Motif
Other DBs
NCBI-GeneID: 937539
NCBI-ProteinID: NP_390642
Pasteur: BG13802
BSORF: BG13802
UniProt: O32046
Position
complement(2826245..2826742)
Genome map
AA seq 165 aa AA seqDB search
MRVRESELPGIGQKVEMITRNRDKISIIIHHDGRRELYYFDENDHEECVASVQFDDAEAR
QMSAILGGMAYKPKALEQVESALDDLIIEWCKAEAGAPAIHQTIGDLNVGQEYHVTVIAI
VKKNQDKQLNPSSETVIDEGDTLVISGEGTGLKRLIREKLTAKGA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagggttcgcgaatcagagctgccgggcataggacaaaaagttgaaatgattactaga
aaccgtgataaaatttcaattatcattcatcatgacggacggagagagctttactatttt
gacgaaaacgaccatgaggaatgtgttgcctccgtgcagtttgatgacgctgaagcaagg
caaatgtctgcaattcttggcggaatggcatataaaccgaaagcattagaacaggtcgag
tcagcccttgatgatttgattatagagtggtgtaaagcagaggcgggagcgcctgccatt
catcagacgattggtgatttgaatgtgggtcaggaatatcatgtgacggtcattgcaatt
gttaaaaagaatcaggataaacaactgaatccgagctctgaaacagtcattgacgaaggc
gatacacttgtgatttccggtgagggaaccggactgaagaggctgatccgggaaaaatta
acagcaaagggagcttaa

DBGET integrated database retrieval system