KEGG   Bacillus subtilis subsp. subtilis 168: BSU27660
Entry
BSU27660          CDS       T00010                                 

Gene name
comN
Definition
(RefSeq) post-transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Post_transc_reg DAP3
Other DBs
NCBI-GeneID: 937536
NCBI-ProteinID: NP_390644
Pasteur: BG13814
BSORF: BG13814
UniProt: O32049 A0A6M3ZEK9
Position
complement(2829152..2829448)
AA seq 98 aa
MEKHPADLYKDHVRPFLYSKLEEFKILGYDDVELESLWSYLTDKKWKKKTELSIYELASD
ILSVKIGEFMNYATVESFKTSNWLGSEEGQEALEELLR
NT seq 297 nt   +upstreamnt  +downstreamnt
gtggagaagcatccagccgatctatataaagaccacgtcaggccgtttctttacagcaaa
ctggaagagtttaagattctcgggtatgatgatgttgaactcgaaagtttgtggtcatac
ttaacagataagaagtggaaaaagaaaacggaactgagcatttatgaactggcgagtgat
attttatcagtgaaaattggcgaatttatgaactatgcaaccgttgagtcatttaaaacg
tctaattggctgggcagtgaagagggccaggaagcattggaagaactgctgagatag

DBGET integrated database retrieval system