KEGG   Bacillus subtilis subsp. subtilis 168: BSU27670Help
Entry
BSU27670          CDS       T00010                                 

Gene name
spoVB
Definition
(RefSeq) stage V sporulation protein B
  KO
K06409  stage V sporulation protein B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27670 (spoVB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU27670 (spoVB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MatE MurJ Syndecan
Motif
Other DBs
NCBI-GeneID: 938022
NCBI-ProteinID: NP_390645
Pasteur: BG10778
BSORF: BG10778
UniProt: Q00758
Position
2829564..2831120
Genome map
AA seq 518 aa AA seqDB search
MAKQTFLKGTLILIAAGMVTRMLGFVNRVVIARFIGEEGVGLYMMAAPTFFLATTLTQFG
LPVAISKLVAEASARGDHQKTKNILVMSLTITGVLSLIFTPLFLFFAPVMAETMLTDKRT
LYPLLAITPVVPIIAISSVLRGYFQGKQNMNPLAMSQVLEQVVRISLVAVCTTIFLPYGI
EYAAAGAMLSSVAGELASLLYLFVCFKYKKTIKIRKHFLQSIKNGKQTFTQLMSVSLPTT
GSRFIGNLSWFFEPIVVAQSLAIAGVATVAATKQYGELTGFAMTLLTLPSFITYSLSTAL
VPAISEGMEQKKLQVVEYRLEQAMRLCLLSGGISVVILFVFADELMRVMYGSSGAAVFIK
VMAPFFLLYYFQGPLQAVLQALNLAGAAMMNSLIGALVKTGLIFVLATRPSLGIMGAALA
IVTGMVLVTLLHAATVSKVLPISIKIKEYALSFAVIVICGFISSAIKQYISFGASEAVNL
AGWIAASAAIYMILLLVFRLIKKDELRRIPIIGRLIIR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacagacgtttttaaagggcactcttatccttatcgcagcaggaatggttaca
agaatgctcgggtttgtcaaccgggtggttatcgcccgttttatcggtgaagaaggagtc
gggctttacatgatggcagcgcctactttcttcttggccactacattaactcaattcggt
ctgccggtcgcgatcagcaagctagtcgctgaagccagtgcgcgcggagatcatcaaaaa
acgaaaaatattttagtcatgtctctgaccattacgggagtgctcagcctcatctttaca
ccgctgtttctgtttttcgcccctgttatggctgaaacgatgctgacagataagcgaaca
ctgtatccgctcttggccattacgcctgttgtgccgattattgctatatcgagtgtgctg
aggggatactttcaaggaaaacagaatatgaacccgcttgctatgtcacaagtccttgaa
caggttgtccgcatttcactcgtggctgtctgcacaacgatttttctcccttacggaatt
gaatatgctgcagcgggggcaatgctatcctcagtggcaggggagctggcatcacttctt
tatttattcgtttgctttaagtataaaaagacaattaaaatcagaaagcattttttacag
tcaattaaaaacggaaaacaaacctttacccaattaatgagcgtgtcccttccaacaacc
gggagccgctttatcggaaacctctcttggtttttcgagccaatcgtcgtcgctcaaagc
cttgccatcgccggtgtggcaacagttgccgcaacaaagcaatacggggaactaaccggc
tttgccatgacgctgctgactctgcccagctttattacatattctttgtcgaccgcgctt
gttcctgcgatcagtgaaggaatggagcagaaaaaattgcaggtggtggaataccgctta
gaacaggcgatgcgtctctgtctgctcagcggaggcatttcagttgttattttatttgta
tttgcggatgagctgatgagagtgatgtacggttcctcaggcgcagctgtatttataaaa
gtgatggccccgttttttctgctttattatttccaaggcccgcttcaagctgtgctgcag
gcgcttaatttggcaggagctgcgatgatgaacagcttaatcggagcgcttgtcaaaaca
ggccttatttttgtccttgccacaaggccttctcttggcattatgggcgcggcattagcc
attgtgacaggcatggtgctcgtcacgctattgcacgcagcaaccgtaagcaaagtgctg
ccgatcagcatcaaaatcaaggagtacgcgctcagcttcgctgttattgtaatttgcgga
ttcatcagctccgccatcaaacaatatataagctttggagcatctgaggctgtcaatcta
gccggatggattgcggcgagcgccgccatttatatgatcctcctgctcgttttccgttta
attaaaaaagatgagcttcgccgcattcccattatcggacggttgatcatccgataa

DBGET integrated database retrieval system