KEGG   Bacillus subtilis subsp. subtilis 168: BSU27680
Entry
BSU27680          CDS       T00010                                 

Symbol
yrbG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF421 DUF5916 Xol-1_GHMP-like APP_amyloid
Other DBs
NCBI-GeneID: 937535
NCBI-ProteinID: NP_390646
Pasteur: BG13786
BSORF: BG13786
UniProt: O32050 A0A6M4JLS2
Position
complement(2831124..2831780)
AA seq 218 aa
MEELLTIAFRTVVLYFVILVIFRFMGKREIGELSILDLVVFIMMAEIAVLAIENVDDHLF
HTILPMLVLMIIQVTLAYFSLKNRKVRQLLDGKPTIIIKYGKIDEEAMKSQRYNFDDLMV
QLRENSIDRVADVSFAILEPSGKLTIVKKENSGEHRQLEMPLIIDGFIQTENLSRISKDR
KWLLESLQKHGYTNPSDISFCSFTDGEIYIDEKDGHRT
NT seq 657 nt   +upstreamnt  +downstreamnt
atggaagagcttctcactattgcgtttcgcacagtcgtattgtattttgtgatattggtc
atttttcgtttcatgggcaaacgggagatcggagagcttagtattttagatctcgttgtc
tttatcatgatggctgaaattgccgttttagccatagaaaacgtagacgatcatctattt
cataccattttgccaatgcttgtattaatgatcattcaagtgactttggcatacttttct
ttaaaaaaccgaaaagtccgccagcttcttgacggtaagccgaccataattatcaaatat
ggaaaaattgacgaagaagccatgaaatcacagcgttataattttgatgatttaatggtt
cagctcagagaaaatagcatcgacagagtagctgacgtatcatttgctattttagagccg
tcgggcaaactgactattgttaagaaagaaaacagcggagagcatcggcagctcgaaatg
ccgctcattatagacggcttcattcaaacagaaaacctgtccagaatcagtaaagataga
aaatggctgcttgaaagtttgcaaaaacacggatacacaaacccttcagatatttcattt
tgctcgtttacagacggagaaatatatattgatgaaaaagatgggcaccgcacgtga

DBGET integrated database retrieval system