KEGG   Bacillus subtilis subsp. subtilis 168: BSU27690Help
Entry
BSU27690          CDS       T00010                                 

Gene name
yrzE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792 DUF5518 MerE Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 938165
NCBI-ProteinID: NP_390647
Pasteur: BG13815
BSORF: BG13815
UniProt: O32051
Position
2831915..2832367
Genome map
AA seq 150 aa AA seqDB search
MSDGFEQKEQKPFNTGREETIMEETKQVGKGILYGLIAIFSAMLLTSLAVSLLLTATSLE
ESSFNWLITAISFLSLFIGGFISGGKGKERGWMIGALTALSFSLIILLFQYLGFGKTFTA
EQLIFHLGFLGVCMLGGIFGVNMRGNRSST
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggttttgaacaaaaagaacagaagccttttaatacaggcagagaggagaca
atcatggaggaaacgaaacaagttggaaaaggcattctttacggcttaatcgccatattt
tcagccatgctcctgacaagtttagcggtttcacttttattgaccgcaacctcgctggaa
gaatcatcatttaactggctgatcaccgctatctcatttctctctttatttatcggcggg
ttcatttcaggcgggaaaggcaaggaaagaggctggatgattggcgcattgaccgcctta
agtttttctctgattatcttattgtttcagtatttaggattcggaaagacatttacagca
gaacagctgatcttccatctgggatttttaggggtgtgcatgctgggcgggattttcggc
gtgaacatgaggggaaacaggtcttccacataa

DBGET integrated database retrieval system