KEGG   Bacillus subtilis subsp. subtilis 168: BSU27710Help
Entry
BSU27710          CDS       T00010                                 

Gene name
tgt
Definition
(RefSeq) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27710 (tgt)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     BSU27710 (tgt)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU27710 (tgt)
 Prokaryotic Type
    BSU27710 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-GeneID: 937528
NCBI-ProteinID: NP_390649
Pasteur: BG12686
BSORF: BG12686
UniProt: O32053
Position
complement(2832727..2833872)
Genome map
AA seq 381 aa AA seqDB search
MAEQPIRYEFIKECKQTGARLGKVHTPHGSFETPVFMPVGTLATVKTMSPEELKAMDAGI
ILSNTYHLWLRPGQDIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRN
HLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLNAH
NRQDEQGLFGIVQGGEYEDLRTQSAKDLISLDFPGYAIGGLSVGEPKDVMNRVLEFTTPL
LPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTAEGRLNMKNAKFERD
FRPIDEECDCYTCKNYTRAYIRHLIRCNETFGLRLTTYHNLHFLLHLMEQVRQAIREDRL
GDFREEFFERYGYNKPNAKSF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacaaccaatacgctatgaatttataaaagaatgcaaacaaacaggagcgcgg
ctgggcaaagtgcatacgcctcacggctccttcgaaacgccggtttttatgccggtcggc
acactggcgacagtcaaaacaatgtcgcctgaagagctgaaagcaatggatgcaggcatc
attttgagcaacacttatcatctatggcttcgtccgggccaagacattgtcaaagaagcg
ggcgggctccataaatttatgaactgggaccgcgcaattttaacagattcaggcggtttt
caggtcttttctttaagcaagtttcgtaatatagaggaagagggtgtccatttccgcaat
catctaaatggagacaagctgtttttatctccggaaaaagcgatggagatccaaaacgca
ctcggctctgatattatgatggcgtttgacgaatgcccgccatacccggcggagtacgac
tacatgaagaggtcagttgaacggacaagccgctgggcggaacgctgcctgaatgcccac
aatcgtcaggatgaacaagggctgtttggtattgtacaaggcggagaatatgaagatctg
cggacacaaagtgcgaaggacttgatttcgcttgattttccgggatatgctataggcgga
ttgtctgtaggtgaaccgaaggatgtcatgaaccgtgtactcgaattcacaacaccgctc
ttgccgaaggataaaccgagatatctgatgggagtaggttctccggacgcactgatcgac
ggagcgatccgcggggtcgatatgtttgactgtgtgctgcctacacggattgcaagaaac
ggcacagtgtttactgctgaaggacgactcaatatgaaaaatgcgaaatttgaaagagac
ttccgtccgattgatgaagagtgtgattgctatacatgtaaaaactacactcgcgcgtac
attaggcacttgattcgctgcaatgaaacattcggccttcgattaacaacttaccataac
cttcattttctgttacacttaatggagcaggtaagacaggctattcgcgaggatcgtctg
ggtgatttcagagaagagttctttgagcgttacggctataacaagccaaatgcgaaaagc
ttctaa

DBGET integrated database retrieval system