KEGG   Bacillus subtilis subsp. subtilis 168: BSU27720Help
Entry
BSU27720          CDS       T00010                                 

Gene name
queA
Definition
(RefSeq) S-adenosylmethionine:tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27720 (queA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     BSU27720 (queA)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU27720 (queA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth Lar_N
Motif
Other DBs
NCBI-GeneID: 937975
NCBI-ProteinID: NP_390650
Pasteur: BG12662
BSORF: BG12662
UniProt: O32054
Structure
PDB: 

Position
complement(2833899..2834927)
Genome map
AA seq 342 aa AA seqDB search
MKVDLFDFELPERLIAQVPLEQRDASRLMVLDKHTGELTDSSFKHIISFFNEGDCLVLNN
TRVLPARLFGTKEDTGAKVELLLLKQETGDKWETLAKPAKRVKKGTVVTFGDGRLKAICT
EELEHGGRKMEFQYDGIFYEVLESLGEMPLPPYIKEQLDDKERYQTVYSKEIGSAAAPTA
GLHFTEEILQQLKDKGVQIEFITLHVGLGTFRPVSADEVEEHNMHAEFYQMSEETAAALN
KVRENGGRIISVGTTSTRTLETIAGEHDGQFKASSGWTSIFIYPGYEFKAIDGMITNFHL
PKSSLIMLVSALAGRENILRAYNHAVEEEYRFFSFGDAMLII
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgatttatttgattttgaactaccagaacgtttaattgcacaagtaccgttg
gagcagcgtgatgcttcaaggctgatggtgctcgataaacatacaggagagcttactgac
agctcgtttaaacacattatcagcttctttaacgaaggcgattgtctagtcctgaacaat
acccgggtactgcctgcgcggttattcggcacaaaagaggataccggcgcgaaagtggaa
cttcttttgttgaaacaggaaaccggtgataaatgggaaacacttgccaaaccggcgaaa
cgggtgaaaaaaggaactgttgtcacatttggagacggaagattgaaggcaatctgcacg
gaagagcttgagcacggcggcagaaagatggaatttcaatatgacggtattttctacgag
gtgcttgaatcccttggagagatgccgctccctccatatatcaaagaacagcttgatgac
aaagagcgctaccagacagtgtattcaaaagaaattggctctgctgctgcgcctacagct
ggccttcacttcacggaagaaatcttacagcagctgaaagacaaaggcgtgcaaattgag
ttcatcacactgcacgtaggccttggaacgtttcgccctgtgagtgccgatgaagtggaa
gagcataatatgcatgcagagttttatcaaatgtcagaagaaacggctgcagccttaaac
aaagtaagagaaaatggcggtcggatcatttctgtcggcacgacctcgacacgcacgctt
gagacgattgccggagaacatgacgggcaatttaaagcatcaagcggctggacatctatt
tttatttatccgggctatgaatttaaagccattgacggaatgattacaaacttccatttg
ccgaaatcgtcattgattatgctggtcagcgcgcttgctggaagagaaaacattctgcgt
gcctataaccatgcagtggaagaggaataccgtttcttcagcttcggagacgcgatgctg
attatataa

DBGET integrated database retrieval system