KEGG   Bacillus subtilis subsp. subtilis 168: BSU27729Help
Entry
BSU27729          CDS       T00010                                 

Gene name
yrzS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2905 DUF4134
Motif
Other DBs
NCBI-GeneID: 8303137
NCBI-ProteinID: YP_003097768
UniProt: C0H463
Position
complement(2834957..2835157)
Genome map
AA seq 66 aa AA seqDB search
MTEFPKIIMILGAVLLIIGAVLHFVGKMPGDIFVKKGNVTFFFPVVTCIIISVVLSILLN
LFGRMK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatttcctaagatcattatgattcttggtgctgttttgcttattatcggagca
gttttgcattttgtcggcaagatgccgggagatatttttgtaaaaaaaggaaatgttacg
tttttcttcccggttgtcacttgtattattataagtgtggtattatcaattttgcttaat
ctttttggcagaatgaaataa

DBGET integrated database retrieval system