KEGG   Bacillus subtilis subsp. subtilis 168: BSU27730Help
Entry
BSU27730          CDS       T00010                                 

Gene name
ruvB
Definition
(RefSeq) holliday junction ATP-dependent DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU27730 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU27730 (ruvB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BSU27730 (ruvB)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU27730 (ruvB)
    RecFOR pathway proteins
     BSU27730 (ruvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 TIP49 Mg_chelatase DUF815 Sigma54_activat AAA_22 AAA_16 Rad17 TsaE AAA_3 NB-ARC NTPase_1 Resolvase AAA_24 AAA_18 AAA_25 AAA_14 Sigma54_activ_2 RNA_helicase TniB Bac_DnaA AAA_17 AAA_33 IstB_IS21
Motif
Other DBs
NCBI-GeneID: 2914219
NCBI-ProteinID: YP_054590
Pasteur: BG12669
BSORF: BG12669
UniProt: O32055
Position
complement(2835150..2836154)
Genome map
AA seq 334 aa AA seqDB search
MDERLVSSEADNHESVIEQSLRPQNLAQYIGQHKVKENLRVFIDAAKMRQETLDHVLLYG
PPGLGKTTLASIVANEMGVELRTTSGPAIERPGDLAAILTALEPGDVLFIDEIHRLHRSI
EEVLYPAMEDFCLDIVIGKGPSARSVRLDLPPFTLVGATTRVGLLTAPLRDRFGVMSRLE
YYTQEELADIVTRTADVFEVEIDKPSALEIARRSRGTPRVANRLLRRVRDFAQVLGDSRI
TEDISQNALERLQVDRLGLDHIDHKLLMGMIEKFNGGPVGLDTISATIGEESHTIEDVYE
PYLLQIGFIQRTPRGRIVTPAVYHHFQMEAPRYD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacggctcgtctcaagtgaagcagacaaccatgaatcagtgatagagcaaagc
ctgaggccgcaaaatctggcacagtatatcgggcagcataaggtaaaagaaaatttgcgc
gtgtttatagatgcggcgaaaatgagacaggagacgctggatcatgttcttctgtacggg
ccgcccggactcggaaaaacaacgcttgcttcgattgttgctaatgaaatgggagtggaa
ttgcggacgacatcagggcctgcgattgaaaggcctggtgatttggctgctatattaacg
gcgctggaaccgggagatgtattatttattgatgaaatacataggctgcacagatcgatc
gaagaggtgctttatcctgcaatggaagacttttgcctggacattgtgattggcaaaggc
ccatctgcccgctcggttcgcctcgaccttccgccttttacgctggtgggagccacgacg
agggtggggcttttgacggctcctttaagagacagattcggcgtaatgtctcgccttgag
tactatacacaagaagaactggcggatattgtcacaagaaccgctgatgtattcgaggtt
gagattgataaaccgtcggctcttgaaattgcaagaagatcgagagggacgccccgcgtg
gcgaaccgcctgctgagaagggtgcgcgatttcgcccaagtgctgggtgacagcaggatt
acggaagacatttctcagaatgcgctggagcggcttcaggttgaccgcctcggtttggat
catattgatcataagctgctgatgggcatgatcgaaaaattcaacggcggcccagtaggc
cttgatacgatttcagctaccatcggcgaggaatcgcatacgattgaagacgtatatgaa
ccatatctgctgcaaattggatttatacaaagaacgccgcgtggaaggatcgtgacaccg
gccgtttatcatcatttccaaatggaggctccccgatatgactga

DBGET integrated database retrieval system