KEGG   Bacillus subtilis subsp. subtilis 168: BSU27740
Entry
BSU27740          CDS       T00010                                 

Symbol
ruvA
Name
(RefSeq) holliday junction ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU27740 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU27740 (ruvA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU27740 (ruvA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU27740 (ruvA)
    RecFOR pathway proteins
     BSU27740 (ruvA)
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH WIYLD Nup35_RRM_2 5_3_exonuc CPSase_L_D3 IMS_HHH
Other DBs
NCBI-GeneID: 937829
NCBI-ProteinID: NP_390652
Pasteur: BG11973
BSORF: BG11973
UniProt: O05392 A0A6M3ZEZ7
Position
complement(2836165..2836770)
AA seq 201 aa
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERSQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEEIGLTTDQYVKKALQKLLK
NT seq 606 nt   +upstreamnt  +downstreamnt
gtgattgaatttgttaaagggacgattgattatgtatctccccaatatattgtcatagag
aacggcggcatcggctatcagattttcacgccgaatccgtttatatataaggagagaagc
caagaaacgatttttacataccatcatatcagagaggatgctttttcgctttatggtttt
tcaacaagagaggagaaggcgctctttacaaagctgttaaacgtgaccggaattggcccg
aaaggagcacttgccatcttgggctcgggtgatcccggagcggtcatccaagcaattgaa
aatgaagatgaagcttttttggtcaagtttcctggagtaggaaagaaaaccgcacgccag
attattctagatttaaaaggaaagctggcagatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaagcaaacagcggaaacggctcttgaagaagcactt
gaagccctcagggttctcggatatgctgaaaaagaaatcaaaaaggtgcttcctcacctt
aaagaagaaattgggctgacaacagaccaatatgtgaaaaaagcattacaaaaactatta
aagtaa

DBGET integrated database retrieval system