KEGG   Bacillus subtilis subsp. subtilis 168: BSU27750
Entry
BSU27750          CDS       T00010                                 

Gene name
bofC
Definition
(RefSeq) general stress protein BofC
  KO
K06318  forespore regulator of the sigma-K checkpoint
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU27750 (bofC)
SSDB
Motif
Pfam: BofC_C BOFC_N
Other DBs
NCBI-GeneID: 937526
NCBI-ProteinID: NP_390653
Pasteur: BG11917
BSORF: BG11917
UniProt: O05391 A0A6M4JNL4
Structure
PDB: 
2BW2

Position
complement(2836909..2837421)
AA seq 170 aa
MKRFSTAYLLLGILCSAAVFLIGAPSRALGAEVEHYEPLQVHVQLEKVYLDGDVSIEHKH
EKVFSMDDFWAAYAGWTLVEQKKGYVLFRKQMDDISPLSKVNGYIGVSDNGVISTFHGRP
EPASEPIQSFFQIDLERLESHMQKNLLKGIPFRTKAEFEDVIEHMKTYSG
NT seq 513 nt   +upstreamnt  +downstreamnt
gtgaaacgattcagcacggcgtatcttttgctgggcattctttgctcagcggcagtattt
ttaataggagctccttcccgcgcacttggcgcggaagtggagcactatgagccgctgcag
gtgcatgtgcagcttgaaaaggtgtatttggacggcgatgtcagcattgagcataagcat
gaaaaagtgttttctatggatgatttttgggcagcttatgccggatggacgctagtggaa
caaaaaaagggatatgtgctcttccggaagcaaatggacgatatttctccgctcagcaag
gtcaacgggtatatcggtgtatcggataatggagtgatttccacttttcatgggcggcct
gagccagcttccgaaccaattcagtctttttttcaaattgatttagaaaggctggaaagc
catatgcaaaaaaatctgctgaaaggcattccatttcggacaaaagcggagtttgaggat
gtcatcgaacatatgaagacatacagcgggtag

DBGET integrated database retrieval system