KEGG   Bacillus subtilis subsp. subtilis 168: BSU27760Help
Entry
BSU27760          CDS       T00010                                 

Gene name
csbX
Definition
(RefSeq) alpha-ketoglutarate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 937527
NCBI-ProteinID: NP_390654
Pasteur: BG11922
BSORF: BG11922
UniProt: O05390
Position
complement(2837469..2838776)
Genome map
AA seq 435 aa AA seqDB search
MNTVHAKGNVLNKIGIPSHMVWGYIGVVIFMVGDGLEQGWLSPFLVDHGLSMQQSASLFT
MYGIAVTISAWLSGTFVQTWGPRKTMTVGLLAFILGSAAFIGWAIPHMYYPALLGSYALR
GLGYPLFAYSFLVWVSYSTSQNILGKAVGWFWFMFTCGLNVLGPFYSSYAVPAFGEINTL
WSALLFVAAGGILALFFNKDKFTPIQKQDQPKWKELSKAFTIMFENPKVGIGGVVKTINA
IGQFGFAIFLPTYLARYGYSVSEWLQIWGTLFFVNIVFNIIFGAVGDKLGWRNTVMWFGG
VGCGIFTLALYYTPQLIGHQYWVLMIIACCYGAALAGYVPLSALLPTLAPDNKGAAMSVL
NLGSGLCAFIAPGIVSLFIGPLGAGGVIWIFAALYFFSAFLTRFLTISEQSTDVYTEERF
VRENVQTNFDKTVKQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtacatgctaaaggaaatgttttgaacaaaatcggaattccttctcacatg
gtttggggttatattggcgttgtcatctttatggttggagacggcctcgaacaaggctgg
ctgtctccttttctcgttgatcatggtctcagtatgcagcaatccgcatcgttatttacc
atgtacggcattgctgtcaccatctcagcttggctttcaggaacgtttgtccaaacttgg
gggccgagaaaaacgatgactgtcggattgcttgcatttatcctcggttcggccgctttt
atcggctgggcgattcctcatatgtattatccggctctcttgggcagctatgctcttaga
ggcttgggatatccgctgtttgcatactcttttctcgtatgggtgtcatacagcacctct
caaaatattcttggaaaagccgtcggctggttttggtttatgtttacgtgcggccttaac
gtgctcggtccgttctattccagctatgcagttccggcctttggagaaatcaatacgctt
tggagcgctttactgtttgtggcggcaggcggaattcttgccttattttttaacaaagat
aaatttactccgatacaaaaacaagatcagccgaaatggaaagaactgtcgaaggcattt
acgattatgtttgaaaaccctaaggtaggcatcggcggagtggtcaagacgattaatgcg
ataggacaatttggatttgccatctttcttcctacttatttagcacgatacgggtattcg
gtttcggaatggctgcaaatatgggggacgctgttttttgtgaatattgtgtttaatatc
attttcggtgcagtcggagataaactaggctggcgcaatacggtcatgtggtttggcggt
gtcggatgcggtatttttacgctggcgctgtattacacgcctcagctgatcgggcatcag
tattgggtgctcatgattatcgcctgctgctacggcgcggctttagcagggtacgtccca
ttaagcgcgcttttgccgacgcttgcacctgataataaaggtgctgccatgtcagtgttg
aatttgggatctggtttatgtgcgtttatcgcgccgggcatcgtgagtcttttcattggg
ccgctcggtgcaggtggcgtgatttggatctttgcggcattgtattttttcagtgccttt
ctgacgcgattcttgacaatttctgagcaaagcacagatgtgtatacggaggaacggttt
gtcagggaaaatgtgcagacaaattttgataaaacggttaagcagtag

DBGET integrated database retrieval system