KEGG   Bacillus subtilis subsp. subtilis 168: BSU27760
Entry
BSU27760          CDS       T00010                                 

Gene name
csbX
Definition
(RefSeq) alpha-ketoglutarate permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 MFS_1_like
Other DBs
NCBI-GeneID: 937527
NCBI-ProteinID: NP_390654
Pasteur: BG11922
BSORF: BG11922
UniProt: O05390 A0A6M3ZEH3
Position
complement(2837469..2838776)
AA seq 435 aa
MNTVHAKGNVLNKIGIPSHMVWGYIGVVIFMVGDGLEQGWLSPFLVDHGLSMQQSASLFT
MYGIAVTISAWLSGTFVQTWGPRKTMTVGLLAFILGSAAFIGWAIPHMYYPALLGSYALR
GLGYPLFAYSFLVWVSYSTSQNILGKAVGWFWFMFTCGLNVLGPFYSSYAVPAFGEINTL
WSALLFVAAGGILALFFNKDKFTPIQKQDQPKWKELSKAFTIMFENPKVGIGGVVKTINA
IGQFGFAIFLPTYLARYGYSVSEWLQIWGTLFFVNIVFNIIFGAVGDKLGWRNTVMWFGG
VGCGIFTLALYYTPQLIGHQYWVLMIIACCYGAALAGYVPLSALLPTLAPDNKGAAMSVL
NLGSGLCAFIAPGIVSLFIGPLGAGGVIWIFAALYFFSAFLTRFLTISEQSTDVYTEERF
VRENVQTNFDKTVKQ
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaatacagtacatgctaaaggaaatgttttgaacaaaatcggaattccttctcacatg
gtttggggttatattggcgttgtcatctttatggttggagacggcctcgaacaaggctgg
ctgtctccttttctcgttgatcatggtctcagtatgcagcaatccgcatcgttatttacc
atgtacggcattgctgtcaccatctcagcttggctttcaggaacgtttgtccaaacttgg
gggccgagaaaaacgatgactgtcggattgcttgcatttatcctcggttcggccgctttt
atcggctgggcgattcctcatatgtattatccggctctcttgggcagctatgctcttaga
ggcttgggatatccgctgtttgcatactcttttctcgtatgggtgtcatacagcacctct
caaaatattcttggaaaagccgtcggctggttttggtttatgtttacgtgcggccttaac
gtgctcggtccgttctattccagctatgcagttccggcctttggagaaatcaatacgctt
tggagcgctttactgtttgtggcggcaggcggaattcttgccttattttttaacaaagat
aaatttactccgatacaaaaacaagatcagccgaaatggaaagaactgtcgaaggcattt
acgattatgtttgaaaaccctaaggtaggcatcggcggagtggtcaagacgattaatgcg
ataggacaatttggatttgccatctttcttcctacttatttagcacgatacgggtattcg
gtttcggaatggctgcaaatatgggggacgctgttttttgtgaatattgtgtttaatatc
attttcggtgcagtcggagataaactaggctggcgcaatacggtcatgtggtttggcggt
gtcggatgcggtatttttacgctggcgctgtattacacgcctcagctgatcgggcatcag
tattgggtgctcatgattatcgcctgctgctacggcgcggctttagcagggtacgtccca
ttaagcgcgcttttgccgacgcttgcacctgataataaaggtgctgccatgtcagtgttg
aatttgggatctggtttatgtgcgtttatcgcgccgggcatcgtgagtcttttcattggg
ccgctcggtgcaggtggcgtgatttggatctttgcggcattgtattttttcagtgccttt
ctgacgcgattcttgacaatttctgagcaaagcacagatgtgtatacggaggaacggttt
gtcagggaaaatgtgcagacaaattttgataaaacggttaagcagtag

DBGET integrated database retrieval system