KEGG   Bacillus subtilis subsp. subtilis 168: BSU27770Help
Entry
BSU27770          CDS       T00010                                 

Gene name
yrbE
Definition
(RefSeq) oxidoreductase
  KO
K00010  myo-inositol 2-dehydrogenase / D-chiro-inositol 1-dehydrogenase [EC:1.1.1.18 1.1.1.369]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU27770 (yrbE)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU27770 (yrbE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.18  inositol 2-dehydrogenase
     BSU27770 (yrbE)
    1.1.1.369  D-chiro-inositol 1-dehydrogenase
     BSU27770 (yrbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C F420_oxidored Semialdhyde_dh NeuB Gp_dh_N NAD_binding_3 DapB_N Rossmann-like CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 936523
NCBI-ProteinID: NP_390655
Pasteur: BG12280
BSORF: BG12280
UniProt: O05389
Position
complement(2838847..2839872)
Genome map
AA seq 341 aa AA seqDB search
MTKQIVTGIIGAGRIGKLHVQNISRIPHMKIKAISDIQASRIKSWADSHQIEYITSDYRD
LLHDPDIDAIFICSPTAVHAQMIKEAAEAKKHIFCEKPVSFSLDETSEALAAVRKHGVTL
QVGFNRRFDPHFKKIKTIVENGEIGTPHLLKITSRDPEPPNIDYVRTSGGLFMDMSIHDF
DMARYIMGSEVTEVYAKGAALVNPSFAELGDIDTAVITLTFENGAMAVIDNSRQAVYGYD
QRVEVFGTKGSAAADNSRPTTVEVSTADFVMKDKPHFFFLERYKDSYEEEILRFAEAIGT
NQETPCTGNDGLQAGRIARAAQQSLAFGMPVSIEHTEKIAF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacagattgtgacagggattatcggtgcaggccgcatcggcaaacttcatgtt
caaaatataagccggattcctcacatgaaaataaaagcaatctctgacattcaggcgagc
cgtataaaaagctgggccgacagtcatcagattgaatacataacctctgattatcgtgat
ttattacatgatcctgatattgatgctatttttatttgctctcctacagccgtacatgca
cagatgatcaaagaagcagccgaggcgaaaaagcatatattttgtgagaagcccgttagt
ttctctctggacgaaacgagtgaagcgcttgcggctgtccggaaacacggggtaacactt
caagtcggatttaaccgccgctttgatcctcattttaagaaaatcaaaacgattgttgaa
aatggtgaaatcggtacacctcatttattaaaaatcacgtcccgggacccagaacccccg
aatatagattatgtccgtacgtcaggcggattgtttatggatatgtcgatccatgatttt
gatatggccagatatattatgggaagcgaagtgacggaagtgtatgccaaaggggcggct
ttggtgaatccttcttttgcggagctgggtgatattgatacagctgttattacactgact
tttgaaaacggtgccatggctgtgattgataacagccgccaagctgtgtacggatatgac
cagcgggttgaggttttcgggacgaaaggctctgcagcggctgacaatagcaggccgaca
acggttgaggtgtcaacagctgattttgtgatgaaggataaaccgcatttctttttcctt
gaacgctataaggattcatatgaggaggagattctccgttttgcagaagcgatcggcaca
aaccaggagactccctgcaccggcaatgacggtttacaggccgggaggatcgccagagca
gcacagcaatcgcttgcttttggcatgcctgttagcattgagcacactgaaaaaatcgct
ttttaa

DBGET integrated database retrieval system