KEGG   Bacillus subtilis subsp. subtilis 168: BSU27785Help
Entry
BSU27785          CDS       T00010                                 

Gene name
yrzF
Definition
(RefSeq) serine/threonine protein kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Pkinase WaaY FTA2
Motif
Other DBs
NCBI-GeneID: 936570
NCBI-ProteinID: NP_390656
UniProt: O32057
Position
2840110..2840757
Genome map
AA seq 215 aa AA seqDB search
MLTKAEALAHTVIYRKNSRFDKVKEKSEELTLIGKGRSAYVFALTEGGRKMALKVFFPEY
QATAVKEAAIYEKLAGSAFYPDIYETGDSFILMEYIKGETFYNCLKKGIAISDDMIQQVE
EALSDARAAGLNPSDIHLRNLILTETGAVRVIDVARFEQTKTCTQWDDLKSAYHALYKKP
IFPKKIPGFWLEIIAFLYKKDWFQKHFAQRKRKYS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaaaagcagaggcactggcccataccgtcatataccgcaagaacagcagattt
gataaagtcaaagagaaatccgaggaattaacactaatcggcaagggaagaagcgcctat
gtgtttgccttaacagaaggcggtcgaaaaatggcgctgaaagtattttttccggaatat
caagcgacagcagtcaaagaagcagcgatctatgaaaaattagccgggtccgcattctat
cctgacatttacgaaactggcgattcatttattctcatggaatatattaaaggtgaaacc
ttttataactgtctgaagaaaggcattgcaatcagtgatgacatgattcagcaggttgaa
gaagcgctttctgacgcccgggcagccggactgaacccgtcagatattcatttgcggaat
ctgatattgacagaaaccggggcggtgcgggtgattgatgttgcgagatttgagcagaca
aaaacatgcacgcagtgggacgacttaaaatccgcatatcatgcactctacaaaaaaccg
atattccccaaaaagattccgggtttttggctggagatcatcgcatttttatataagaaa
gattggtttcaaaagcatttcgcacagcggaaaagaaaatattcttaa

DBGET integrated database retrieval system