KEGG   Bacillus subtilis subsp. subtilis 168: BSU27800Help
Entry
BSU27800          CDS       T00010                                 

Gene name
yrzH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5412
Motif
Other DBs
NCBI-GeneID: 936007
NCBI-ProteinID: NP_390658
Pasteur: BG13818
BSORF: BG13818
UniProt: O32059
Position
2841169..2841300
Genome map
AA seq 43 aa AA seqDB search
MTWINHNTVKIGNQTLHLDTDETYDWRKDDHWIREEPPQASVR
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtggatcaatcacaatacagtgaaaatcggcaatcagactttacatcttgatact
gatgaaacgtatgattggcgaaaagatgatcattggatccgtgaagaaccgccgcaggcg
tcagtgaggtga

DBGET integrated database retrieval system