KEGG   Bacillus subtilis subsp. subtilis 168: BSU27800
Entry
BSU27800          CDS       T00010                                 

Gene name
yrzH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5412
Other DBs
NCBI-GeneID: 936007
NCBI-ProteinID: NP_390658
Pasteur: BG13818
BSORF: BG13818
UniProt: O32059 A0A6M3ZEZ5
Position
2841169..2841300
AA seq 43 aa
MTWINHNTVKIGNQTLHLDTDETYDWRKDDHWIREEPPQASVR
NT seq 132 nt   +upstreamnt  +downstreamnt
gtgacgtggatcaatcacaatacagtgaaaatcggcaatcagactttacatcttgatact
gatgaaacgtatgattggcgaaaagatgatcattggatccgtgaagaaccgccgcaggcg
tcagtgaggtga

DBGET integrated database retrieval system