KEGG   Bacillus subtilis subsp. subtilis 168: BSU27809
Entry
BSU27809          CDS       T00010                                 

Symbol
yrzT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303183
NCBI-ProteinID: YP_003097769
UniProt: C0H464 A0A6M4JLJ8
Position
2841307..2841447
AA seq 46 aa
MNKMNGTNDEKHFNHFVIALSFIYGLTELGYLLLKDFITIAISLPL
NT seq 141 nt   +upstreamnt  +downstreamnt
atgaataagatgaacggaacaaatgatgaaaagcatttcaatcattttgtgattgcttta
tcctttatatacggtttgactgaactaggctatttgttgctgaaggattttataacaatt
gccataagtttgcctctgtag

DBGET integrated database retrieval system