KEGG   Bacillus subtilis subsp. subtilis 168: BSU27809Help
Entry
BSU27809          CDS       T00010                                 

Gene name
yrzT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303183
NCBI-ProteinID: YP_003097769
UniProt: C0H464
Position
2841307..2841447
Genome map
AA seq 46 aa AA seqDB search
MNKMNGTNDEKHFNHFVIALSFIYGLTELGYLLLKDFITIAISLPL
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatgaacggaacaaatgatgaaaagcatttcaatcattttgtgattgcttta
tcctttatatacggtttgactgaactaggctatttgttgctgaaggattttataacaatt
gccataagtttgcctctgtag

DBGET integrated database retrieval system