KEGG   Bacillus subtilis subsp. subtilis 168: BSU27810Help
Entry
BSU27810          CDS       T00010                                 

Gene name
yrbD
Definition
(RefSeq) sodium/proton-dependent alanine carrier protein YrbD
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU27810 (yrbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ala_symp
Motif
Other DBs
NCBI-GeneID: 937941
NCBI-ProteinID: NP_390659
Pasteur: BG13784
BSORF: BG13784
UniProt: O32060
Position
2841611..2843065
Genome map
AA seq 484 aa AA seqDB search
MADFVASLNAVLWSTPVIYILLGIGFAFSIMTRFLQVRHLKEMIVQMFKGKSSEAGVSSF
QALSIALSGRVGTGNIAGVATAIAFGGPGAVFWMWAIAFIGAASAFVESTLAQIYKVKQD
GQYRGGPAYYIEKGLGIKWFAVLFAAAALIAMAFLMPGVQSNSIAAGIQNAFGISPFVTG
CGLVLLLGFIIFGGVKRIANAAQMIVPFMAIGYILLSLIIIVMNVSELPAVISLIFKSAF
ALDSAFGGLIGMAISWGVKRGIYSNEAGQGTGPHPAAAAEVSHPVKQGLVQAFSVYIDTL
FVCSATAFMILFTGMYNTQAADGSFIVHQLKGVEAGPGFTQAAIDSVLPGFGAGFVAIAL
FFFAFTTIMAYYYIAETNIAYLARGRESKWAMLGLKLIILAATFYGTVKTASLAWALGDA
GLGIMVWLNVIAIVLLAKPALLALKDYERQKKQGLDPIFDPKALGIKNADFWEKEYTHES
ERVS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcagattttgttgctagtttgaatgcggtcttatggagtacgcccgtcatttatatt
ttattgggaattggattcgccttttcaattatgacccgttttttacaagtccgacattta
aaagaaatgattgttcagatgttcaaaggcaagagctctgaagccggcgtttcatctttc
caagcgttatcgattgcgctgtccggccgtgtgggcacaggaaacatcgcgggagtggcg
acagcaattgcattcggcggacccggtgcagtgttctggatgtgggcgattgcctttatc
ggggcggcgagtgcctttgtagaatcaacgcttgctcaaatttacaaagtgaaacaagac
ggtcaatatcggggcggccctgcttattatatagaaaaaggcttaggcattaagtggttt
gccgtcttatttgccgctgctgcccttattgcaatggcctttctaatgccgggcgtacag
tccaactccattgcggctgggatccaaaatgcattcggcatctctcctttcgtcacaggg
tgcggtctggttttattattagggttcattatttttggcggcgtcaaacgaattgccaat
gcggcgcaaatgattgttccatttatggccattggatatatcctgctgtctttgattatt
attgtcatgaatgtgtctgaattgcctgctgtgatctcattaatattcaaaagcgccttc
gcattggattccgcttttggcggcttgatcggtatggcgatttcctggggcgttaaacgt
ggcatttactcaaacgaagccggccagggaacaggcccgcatccggcagctgctgcagag
gtttctcatccggtcaagcagggactggttcaggcattttctgtttatattgacaccttg
tttgtatgttccgctacagctttcatgatcttgtttaccggcatgtacaatacccaggct
gcagatggttcctttatcgttcaccagcttaaaggcgtagaagcaggacctggtttcaca
caagcggcaattgacagtgttcttcccggattcggtgcaggctttgttgccatcgcttta
ttcttcttcgcttttacaacaattatggcgtattactacatcgcagaaacaaatatcgcc
tatttagcacgaggcagagaaagcaaatgggcgatgcttggcttaaaactgattatttta
gccgccacgttctatggtactgtgaaaacagcttcacttgcttgggcattaggggatgca
gggcttggcattatggtatggctgaacgtcattgccattgtgctgcttgccaagccggcg
ctccttgctttaaaggattatgagcgccaaaagaagcagggcttagacccgatctttgat
ccaaaagcgctgggtatcaaaaacgctgatttctgggagaaagaatacactcatgaaagt
gaacgtgtctcctga

DBGET integrated database retrieval system