KEGG   Bacillus subtilis subsp. subtilis 168: BSU27820
Entry
BSU27820          CDS       T00010                                 

Gene name
yrbC
Definition
(RefSeq) transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Transcrip_reg
Other DBs
NCBI-GeneID: 937517
NCBI-ProteinID: NP_390660
Pasteur: BG13783
BSORF: BG13783
UniProt: P94447 A0A6M3ZIR3
Position
complement(2843106..2843828)
AA seq 240 aa
MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGAN
MPNENIDRAIKKAAGGQDGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRTAFNKN
GGSLGESGCVAFLFERKGFITIDRTERQIEEDELMLDVLEAGGEELRIEEDLYEVFTEPE
HFEEVKTALESKYLISSAEVTMLPNTYAEADDQAVEKLETLIDVLEDDDDVQEVYTNYRS
NT seq 723 nt   +upstreamnt  +downstreamnt
atggcaggccattccaagtggaaaaacattcaaaaaagaaaaaatgcacaggatgcaaag
cgcgggaaaatatttatgaagctggcaaaagaaatctatgtggcagcgaaagaaggcgga
gcggatccagaagcaaattcagcattgcgtcttgtcatcgaaaaagcaaaaggcgccaat
atgccgaatgaaaatatagatcgggccattaaaaaagctgcgggaggccaagacggaagc
agctatgaagaaatcacctatgaaggctacggcccttcagggattgccgtcatggttgaa
tgcgtaacagataataaaaaccgaacggcgtcaaatgtgcggacagcctttaataaaaat
ggcggaagtctgggagaaagcggatgtgtagcctttttatttgaacgaaaggggttcatt
acgatagaccgtactgaacggcaaatagaagaagatgagctcatgcttgatgtgcttgaa
gcaggaggagaagagctgcgaattgaagaagacctatatgaggttttcacagagcctgag
cattttgaagaggtgaaaacagccctcgaatcgaaatatctaatttcttcggcggaggtg
accatgcttcccaatacctatgcagaagccgatgatcaggctgttgagaagctggaaaca
ttaatagacgtccttgaagatgacgatgatgttcaagaagtgtatacaaactatcgttca
taa

DBGET integrated database retrieval system