KEGG   Bacillus subtilis subsp. subtilis 168: BSU27830Help
Entry
BSU27830          CDS       T00010                                 

Gene name
coxA
Definition
(RefSeq) sporulation cortex protein CoxA
  KO
K06345  spore cortex protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU27830 (coxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YhcN_YlaJ BON
Motif
Other DBs
NCBI-GeneID: 937516
NCBI-ProteinID: NP_390661
Pasteur: BG13782
BSORF: BG13782
UniProt: P94446
Position
complement(2843931..2844527)
Genome map
AA seq 198 aa AA seqDB search
MGKKMTIASLILMTAGLTACGANDNAMNDTRNNGNTRPIGYYTNENDADRQGDGIDHDGP
VSELMEDQNDGNRNTTNVNNRDRVTADDRVPLATDGTYNNTNNRNMNRNAANNGYDNQEN
RRLAAKIANRVKQVKNVNDTQVMVSDDRVVIAVKSHREFTKSDRDNVVKAARNYANGRDV
QVSTDKGLFRKLHKMNNR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaaaaaatgacgatcgctagcctgattctaatgacagccggcttaacagcatgc
ggagcaaacgataatgctatgaatgatacgcgcaataacggcaatacccgtccaatcgga
tattatacaaatgaaaatgacgccgatagacagggagacggaatcgaccacgatggtcct
gtttctgaattaatggaggatcagaacgacggtaaccgaaacaccacgaatgtaaataac
cgtgaccgtgttactgctgacgatcgtgttcctttggcaactgacggaacatataacaac
acgaataaccgaaacatgaatcggaatgcagcgaacaacgggtatgacaaccaagaaaac
agaagactggctgcaaaaattgccaaccgtgtgaaacaagtgaaaaacgtcaatgacaca
caagttatggtatcggatgaccgagtagttatcgcagtcaaaagccacagagagttcaca
aagtctgacagagataatgttgtaaaagcagcgcgcaactatgcaaatggccgtgacgtc
caagtatcaacagataaagggctgttcagaaaacttcataaaatgaacaaccgctag

DBGET integrated database retrieval system