KEGG   Bacillus subtilis subsp. subtilis 168: BSU27840Help
Entry
BSU27840          CDS       T00010                                 

Gene name
safA
Definition
(RefSeq) spoivd-associated factor A
  KO
K06370  morphogenetic protein associated with SpoVID
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU27840 (safA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM
Motif
Other DBs
NCBI-GeneID: 937514
NCBI-ProteinID: NP_390662
Pasteur: BG13781
BSORF: BG13781
UniProt: O32062
Position
complement(2844675..2845838)
Genome map
AA seq 387 aa AA seqDB search
MKIHIVQKGDSLWKIAEKYGVDVEEVKKLNTQLSNPDLIMPGMKIKVPSEGVPVRKEPKA
GKSPAAGSVKQEHPYAKEKPKSVVDVEDTKPKEKKSMPYVPPMPNLQENVYPEADVNDYY
DMKQLFQPWSPPKPEEPKKHHDGNMDHMYHMQDQFPQQEAMSNMENANYPNMPNMPKAPE
VGGIEEENVHHTVPNMPMPAVQPYYHYPAHFVPCPVPVSPILPGSGLCYPYYPAQAYPMH
PMHGYQPGFVSPQYDPGYENQHHENSHHGHYGSYGAPQYASPAYGSPYGHMPYGPYYGTP
QVMGAYQPAAAHGYMPYKDHDDCGCDGDHQPYFSAPGHSGMGAYGSPNMPYGTANPNPNP
YSAGVSMPMTNQPSVNQMFGRPEEENE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatccatatcgttcaaaaaggcgattcgctctggaaaatagctgaaaagtacgga
gtcgatgttgaggaagtgaaaaaactcaatacacagcttagcaatccagacttaatcatg
cctggaatgaaaataaaagtgccgtcagaaggagtcccggtcagaaaagagccaaaagcg
ggcaaaagtcctgcggccgggagtgtgaagcaagaacatccatatgcgaaagagaagcct
aaatccgttgtcgatgtagaagacacaaagccgaaagaaaagaagtccatgccgtatgtc
ccgccgatgcctaatttgcaggaaaatgtgtaccctgaagctgatgtgaacgattattat
gatatgaaacagcttttccagccttggtcgcctcctaaaccggaggagccgaaaaaacat
catgacggaaatatggatcatatgtatcatatgcaagaccaatttccacaacaggaggct
atgagtaatatggaaaatgcaaattatccgaatatgcctaatatgccaaaggcgccagag
gtaggcggtatagaagaggaaaacgttcatcacacagttccgaatatgccgatgccggct
gttcagccttattatcattatccggctcatttcgtaccgtgtccggtgcctgtttcgcca
attcttccaggatcaggattatgctatccgtactatccggcacaagcttatccaatgcat
ccgatgcatggataccagccaggctttgtatcgcctcagtatgacccgggttatgaaaac
cagcatcatgaaaacagccatcacggacattacggttcatacggtgcgccgcaatacgca
tctccggcttatggatctccgtatggacatatgccgtatggcccttattacggcactccc
caagtaatgggagcataccagcctgctgcggctcatggttacatgccatacaaagatcat
gacgactgcggctgtgacggtgatcatcagccatatttctctgcacctggccattcggga
atgggagcttatggaagccctaatatgccatatggcacagctaacccaaatccaaaccca
tattcggcaggagtttctatgccaatgacgaaccagccttctgtaaaccaaatgtttggc
cgtccggaagaagaaaatgagtga

DBGET integrated database retrieval system