KEGG   Bacillus subtilis subsp. subtilis 168: BSU27850Help
Entry
BSU27850          CDS       T00010                                 

Gene name
nadA
Definition
(RefSeq) quinolinate synthase A
  KO
K03517  quinolinate synthase [EC:2.5.1.72]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Module
bsu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU27850 (nadA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     BSU27850 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NadA Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 937522
NCBI-ProteinID: NP_390663
Pasteur: BG12629
BSORF: BG12629
UniProt: Q9KWZ1
Position
complement(2845955..2847061)
Genome map
AA seq 368 aa AA seqDB search
MSILDVIKQSNDMMPESYKELSRKDMETRVAAIKKKFGSRLFIPGHHYQKDEVIQFADQT
GDSLQLAQVAEKNKEADYIVFCGVHFMAETADMLTSEQQTVVLPDMRAGCSMADMADMQQ
TNRAWKKLQHIFGDTIIPLTYVNSTAEIKAFVGKHGGATVTSSNAKKVLEWAFTQKKRIL
FLPDQHLGRNTAYDLGIALEDMAVWDPMKDELVAESGHTNVKVILWKGHCSVHEKFTTKN
IHDMRERDPDIQIIVHPECSHEVVTLSDDNGSTKYIIDTINQAPAGSKWAIGTEMNLVQR
IIHEHPDKQIESLNPDMCPCLTMNRIDLPHLLWSLEQIEKGEPSGVIKVPKAIQEDALLA
LNRMLSIT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattcttgatgtgatcaaacaatcgaatgatatgatgcccgaaagttataaagaa
ctatcgagaaaggatatggaaacgcgcgttgccgccattaagaaaaagttcggcagcagg
ctctttataccaggccatcattatcaaaaggatgaagtgatacaatttgctgaccaaaca
ggcgactccctgcaattggcccaagtagcggaaaaaaacaaagaagcggattatatcgta
ttttgcggcgttcactttatggcagaaaccgccgatatgctgacaagcgagcagcaaacg
gtcgtcctgccagatatgagagctggatgttctatggctgacatggctgacatgcagcag
accaatagggcatggaagaagcttcagcatatatttggagatacgatcatacctttaact
tatgtgaactccactgcggagatcaaggcattcgtcggaaagcatggcggagcaactgta
acttcttcgaatgcgaaaaaagtgcttgaatgggcgtttacacagaaaaaaagaatttta
tttttgcctgatcagcatttagggagaaatacggcttatgatctgggcattgcgcttgaa
gatatggctgtgtgggatccgatgaaagatgaattagtagctgaatccgggcatacgaat
gtgaaagtgattttgtggaaagggcattgctctgttcacgagaaattcaccactaaaaat
atccatgatatgagagagcgagaccccgacattcagatcattgtgcacccggaatgttca
cacgaagtcgtgacactaagcgatgataacggatcaacgaaatatattatcgacacaatc
aaccaggctccggcgggaagcaagtgggcaatcgggacagaaatgaatcttgttcagcgg
atcattcacgagcatccagataaacaaatcgaatcactcaaccctgacatgtgcccttgc
ctgacaatgaaccgaattgatttgccgcatttgttgtggtcgctggaacaaattgaaaaa
ggagaaccttcaggcgtcatcaaggtgccaaaagccattcaggaagatgcactccttgcc
ctgaatcgaatgctttcgatcacgtag

DBGET integrated database retrieval system