KEGG   Bacillus subtilis subsp. subtilis 168: BSU27860Help
Entry
BSU27860          CDS       T00010                                 

Gene name
nadC
Definition
(RefSeq) nicotinate-nucleotide pyrophosphorylase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Module
bsu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU27860 (nadC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     BSU27860 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QRPTase_C QRPTase_N B12-binding
Motif
Other DBs
NCBI-GeneID: 936245
NCBI-ProteinID: NP_390664
Pasteur: BG10868
BSORF: BG10868
UniProt: P39666
Position
complement(2847048..2847917)
Genome map
AA seq 289 aa AA seqDB search
MNHLQLKKLLNHFFLEDIGTGDLTSQSIFGEQSCEAEIVAKSEGIFAGAAIIKEGFSLLD
ENVQSILHKKDGDMLHKGEVIAELHGPAAALLSGERVVLNLIQRLSGIATMTREAVRCLD
DEQIKICDTRKTTPGLRMLEKYAVRAGGGYNHRFGLYDGIMIKDNHIAACGSILEACKKA
RQAAGHMVNIEVEIETEEQLREAIAAGADVIMFDNCPPDTVRHFAKLTPANIKTEASGGI
TLESLPAFKGTGVNYISLGFLTHSVKSLDISMDVTLSNESVEECCYVNS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttacagctgaaaaaattactgaatcacttttttcttgaggatattgggaca
ggggatcttacatcgcagtctatttttggagaacagagctgtgaagcggagattgttgca
aagtcagagggtatttttgcaggagcagcgatcataaaagaaggcttttcgttattggac
gaaaatgttcaaagcattttacacaaaaaagatggggacatgttgcataaaggtgaagtg
attgccgagttacacggtcccgcagctgcgctcctttcaggagagcgggtcgtattaaat
cttattcagaggctgtcaggaattgcgacaatgacaagagaggctgttcggtgtctggat
gatgaacagattaaaatttgtgacacgagaaaaacaacaccggggctcagaatgctggag
aaatatgctgtcagagccggcggcgggtataatcatcgattcggtttgtatgacggcatc
atgattaaagataatcatatcgcagcatgcggctctattttagaggcgtgcaaaaaagcc
cgtcaggccgcagggcacatggtaaatatcgaggtggaaattgaaacggaggaacagctg
cgggaagcaattgcagctggagcggatgttattatgtttgacaactgtccgcctgatacg
gtccgtcattttgcaaagctcacaccggctaatataaaaactgaagcctctggcgggatt
acgttagaatctttgcctgcttttaaagggacgggtgtgaattatatttcattaggattt
ctgactcattccgtcaaaagtttagatatcagcatggatgttacgttatcaaatgaatct
gtggaggaatgctgttatgtcaattcttga

DBGET integrated database retrieval system