KEGG   Bacillus subtilis subsp. subtilis 168: BSU27870Help
Entry
BSU27870          CDS       T00010                                 

Gene name
nadB
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
Module
bsu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU27870 (nadB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU27870 (nadB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     BSU27870 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Hemolysin_N
Motif
Other DBs
NCBI-GeneID: 938051
NCBI-ProteinID: NP_390665
Pasteur: BG10867
BSORF: BG10867
UniProt: P38032
Position
complement(2847871..2849466)
Genome map
AA seq 531 aa AA seqDB search
MSKKTIAVIGSGAAALSLAAAFPPSYEVTVITKKSVKNSNSVYAQGGIAAAYAKDDSIEA
HLEDTLYAGCGHNNLAIVADVLHDGKMMVQSLLERGFPFDRNERGGVCLGREGAHSYNRI
FHAGGDATGRLLIDYLLKRINSKIKLIENETAADLLIEDGRCIGVMTKDSKGRLKVRHAD
EVVLAAGGCGNLFLHHTNDLTVTGDGLSLAYRAGAELTDLEFTQFHPTLLVKNGVSYGLV
SEAVRGEGGCLVDENGRRIMAERHPLGDLAPRDIVSRVIHEEMAKGNRVYIDFSAISDFE
TRFPTITAICEKAGIDIHSGKIPVAPGMHFLMGGVSVNRWGETTVPGLYAIGETACSGLH
GANRLASNSLLEALVFGKRAAEHIIQKPVYNRQYQSGLETSVFYEVPDIEGHELQSKMTS
HMSILREQSSLIELSIWLHTLPFQEVNVKDITIRQMELSHLWQTAKLMTFSALLREESRG
AHFRTDFPHAEVSWQGRQIVHTKKGTKIRKNEGIWNNESFTAEKITESLFS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaagacgattgcagtcatcggttcaggggcggcggcactttccttagctgca
gctttcccgccctcatacgaagtgactgttatcacaaaaaaaagcgtcaaaaacagcaat
tctgtctatgcacaaggcgggattgctgcggcctatgcaaaagatgactcgattgaagcc
catctggaggatacgttatacgcagggtgcggccataataatctagctattgtagcagac
gtattacatgatggaaaaatgatggttcaaagcctattggagcgtggatttccattcgac
cgcaatgaacgaggcggtgtttgtcttggaagagaaggggcccactcatacaaccgcata
tttcatgcaggcggagacgcaacaggcaggctgcttatcgattatttgctcaaacggatc
aacagcaaaatcaagttaatcgagaatgaaacggcagcagatttgcttatagaggacgga
cgatgtatcggcgtcatgacaaaagacagcaaagggcggctcaaggtaaggcacgcagac
gaagttgtgctggctgccggcggctgtggaaacctgtttcttcaccatacgaatgatctc
actgtcacaggtgacggtctttctctggcttaccgggccggggcggaattaacggatttg
gagtttactcagtttcacccgacactgcttgtgaaaaatggtgtttcctacgggcttgtt
tcagaagctgtcagaggggaaggcggatgtttagtagacgaaaacggccgcaggattatg
gctgaacggcatcctttaggtgacctggctccaagagatattgtctcacgggttattcac
gaagaaatggcaaaaggaaatcgcgtttatatagacttcagtgcgatttctgattttgaa
acgcgtttccctaccatcaccgctatttgtgaaaaagcagggattgatatccacagcgga
aaaattcctgttgctccgggaatgcatttcttaatgggaggtgtttcagttaatcgctgg
ggagaaacgacagtgccggggctttatgcgattggcgagacagcatgctccggtttacat
ggagcaaaccggcttgcaagcaattctttattggaagcgctggtatttggaaaaagggca
gcagagcatattatccaaaaaccggtttataacaggcaatatcaatcagggctagaaacc
agtgtcttctacgaggtgccggatatagaggggcatgaactgcaaagcaaaatgacaagc
cacatgtctattctgcgggaacaaagcagtttgattgagcttagcatctggcttcatacg
ctgccttttcaggaagtaaatgtgaaggatatcacaattcggcagatggaactttctcat
ctatggcaaactgcaaagctgatgacgttttctgcgcttttgcgggaggaaagcagaggg
gctcacttccgcaccgattttcctcatgctgaggtgagctggcaaggaagacaaattgtc
catacaaaaaaaggaacgaagatcagaaaaaacgaggggatttggaacaatgaatcattt
acagctgaaaaaattactgaatcacttttttcttga

DBGET integrated database retrieval system