KEGG   Bacillus subtilis subsp. subtilis 168: BSU27880Help
Entry
BSU27880          CDS       T00010                                 

Gene name
nifS
Definition
(RefSeq) cysteine desulfurase NifS
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00730  Thiamine metabolism
bsu01100  Metabolic pathways
bsu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSU27880 (nifS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BSU27880 (nifS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU27880 (nifS)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU27880 (nifS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU27880 (nifS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BSU27880 (nifS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    BSU27880 (nifS)
 Prokaryotic Type
    BSU27880 (nifS)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BSU27880 (nifS)
Prokaryotic defense system [BR:bsu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   BSU27880 (nifS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 936637
NCBI-ProteinID: NP_390666
Pasteur: BG10866
BSORF: BG10866
UniProt: P38033
Position
2849569..2850756
Genome map
AA seq 395 aa AA seqDB search
MIYLDYAATTPICEEALTVYQKLSMDMYGNASSLHDAGGKAKHILEYCREKIANIIGGEA
SGIYFTSGGTESNFLAIQSLLNGLPKTKRHFITTAMEHQSIHNCAAFLEQQGYDVTVIEP
NEYGLITEEILLTHIRPETGLVSIQHANSETGIIQPIQHLSSYLHNKGILLHCDAVQTFG
KIPINTKNLGVDALSMSSHKIHGPKGVGAVYIRPDVPWKPVYPLTTHEYGFRAGTVNVPG
IGAFTAAAELIVSEMEKQISRNEALRTYFLDQIRIRSLPVTLAADTSKAECLPHIIGCFF
HSFEGQYVMLECNRSNICISTGSACSAGYHGPSETMKALRKTEQEALQFIRISFGRHTTA
EQLEQLLHTFTVLWEQKKGEFDIDRRIKANGRQQA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgatttatttagattatgcagcgacaacgcctatttgtgaggaagcccttactgtatat
cagaagcttagtatggatatgtacggaaatgccagcagcctgcatgatgcaggaggaaaa
gcaaagcacatactggagtactgccgtgaaaaaatcgccaacatcattggcggagaagca
agcggcatctattttacaagcggcggcactgaatccaattttctggccattcaatcattg
ttaaacggcctgccaaaaacgaaaagacattttattacgactgccatggagcatcagtcc
attcataattgcgctgcttttttggaacagcagggatatgatgtaacagtcattgaaccg
aatgaatacgggcttattaccgaggaaatattactaacccatatccggccggaaacaggc
cttgtatctattcagcatgcaaattctgaaaccgggatcattcagcccattcaacacctg
tcttcatacctgcacaataaggggattcttcttcattgcgacgctgttcaaacgtttgga
aagatcccgatcaatacaaaaaatctgggagtagatgcactctcaatgtccagccataaa
atccacggtcctaaaggagtaggggcggtctatatccggccggatgtcccttggaaaccc
gtttatcctctgactactcacgaatacggattcagagccggcaccgtaaatgttcccggg
atcggtgccttcactgccgctgcagaattgatcgtaagcgaaatggaaaaacagatatcc
cgcaatgaggcattaagaacatactttctagaccaaatccgtattcggtctctccctgta
acccttgcagcagacacttcgaaagcagaatgtcttccgcatattatagggtgttttttt
cactcatttgaaggacaatatgttatgttagaatgtaatcggagtaatatttgcatttca
accggcagcgcttgttctgcaggttaccacggtccgtctgaaacaatgaaagcattaaga
aaaaccgaacaagaagctctgcaatttatccgcatctcttttggcaggcatacaacagct
gaacagctggaacagttattacatacgtttacagtgctttgggaacaaaagaaaggagaa
tttgatattgaccgaagaattaaagctaatgggcgccaacaggcgtga

DBGET integrated database retrieval system