KEGG   Bacillus subtilis subsp. subtilis 168: BSU27890
Entry
BSU27890          CDS       T00010                                 

Gene name
nadR
Definition
(RefSeq) transcription repressor NadR
  KO
K07105  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU27890 (nadR)
SSDB
Motif
Pfam: 3H HTH_11 MarR_2 DUF1326 DUF1508
Other DBs
NCBI-GeneID: 937515
NCBI-ProteinID: NP_390667
Pasteur: BG10865
BSORF: BG10865
UniProt: P39667 A0A6M3ZER1
Position
2850716..2851258
AA seq 180 aa
MTEELKLMGANRRDQLLLWLKESKSPLTGGELAKKANVSRQVIVQDISLLKAKNVPIIAT
SQGYVYMDAAAQQHQQAERIIACLHGPERTEEELQLIVDEGVTVKDVKIEHPVYGDLTAA
IQVGTRKEVSHFIKKINSTNAAYLSQLTDGVHLHTLTAPDEHRIDQACQALEEAGILIKD
NT seq 543 nt   +upstreamnt  +downstreamnt
ttgaccgaagaattaaagctaatgggcgccaacaggcgtgaccagcttcttctgtggctg
aaggaatctaaatcaccgctgacaggaggagaactcgcaaaaaaagcgaacgtctcaaga
caggttattgtacaggatatatcgctcttgaaagcgaaaaatgtaccgattatcgccaca
agccaaggatatgtatacatggatgcagccgctcagcagcaccagcaggcagaaagaatc
atagcatgtctgcacggtcctgaacggacagaagaggaactgcagctcatcgtcgacgaa
ggcgttacagtaaaagacgtaaaaatcgagcatcccgtatacggagatttaactgcagcc
atccaagtaggcacccggaaagaagttagccatttcatcaaaaaaatcaattctacgaat
gctgcctacttatcacagctgaccgacggcgtgcacctgcatacactgacagcacctgat
gaacatcgcatcgatcaagcctgccaagccctcgaagaagccggcattttaattaaagac
taa

DBGET integrated database retrieval system