KEGG   Bacillus subtilis subsp. subtilis 168: BSU27900Help
Entry
BSU27900          CDS       T00010                                 

Gene name
pheA
Definition
(RefSeq) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU27900 (pheA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     BSU27900 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT RVT_1
Motif
Other DBs
NCBI-GeneID: 937513
NCBI-ProteinID: NP_390668
Pasteur: BG10914
BSORF: BG10914
UniProt: P21203
Position
complement(2851283..2852140)
Genome map
AA seq 285 aa AA seqDB search
MKVGYLGPAATFTHLAVSSCFQNGAEHVAYRTIPECIDAAVAGEVDFAFVPLENALEGSV
NLTIDYLIHEQPLPIVGEMTLPIHQHLLVHPSRENAWKELDKIYSHSHAIAQCHKFLHRH
FPSVPYEYANSTGAAAKFVSDHPELNIGVIANDMAASTYELKIVKRDIQDYRDNHTRFVI
LSPDENISFEVNSKLSSRPKTTLMVMLPQDDQSGALHRVLSAFSWRNLNLSKIESRPTKT
GLGHYFFIIDIEKAFDDVLIPGAMQELEALGCKVRLLGAYQSYQL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcggttatttaggtccagcagctacatttacacatctagcagtcagttcttgt
tttcaaaacggcgccgaacatgttgcttaccgcaccattccggagtgtatagatgcagcc
gttgcaggcgaagttgattttgcttttgttcctttggaaaatgctttagaaggatctgtt
aatctaacaatagactatttaatacatgaacagcctttgccaatcgtgggtgaaatgacg
ttgccgattcaccagcacttgctcgtccatccctcaagagagaatgcatggaaagagctc
gacaaaatttactcacattcacacgcgattgcgcaatgccataaatttcttcatcgacat
tttccttccgttccatatgaatacgccaattctaccggggcggcagcaaagtttgtcagt
gaccatcccgagctgaatatcggggtcattgccaatgatatggcagcttctacatacgaa
ttaaaaatcgtgaaacgggatatacaggattatagggacaatcatacaagatttgttatc
ctgtctcccgatgaaaacatatcttttgaagtgaattcaaaattgagctctaggcccaaa
acgaccttaatggtcatgctgccgcaggatgatcagtccggggcgctgcatagagtgctg
tctgcattttcttggagaaatttaaacctgtcaaaaattgagtcacgtccgactaaaacc
ggattaggccattatttctttattattgatattgagaaagcgtttgatgatgtattgatt
ccaggggccatgcaggagcttgaagcactcggctgcaaagtgaggcttctgggtgcatac
cagtcttaccaattataa

DBGET integrated database retrieval system