KEGG   Bacillus subtilis subsp. subtilis 168: BSU27910Help
Entry
BSU27910          CDS       T00010                                 

Gene name
pheB
Definition
(RefSeq) hypothetical protein
  KO
K06209  chorismate mutase [EC:5.4.99.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU27910 (pheB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     BSU27910 (pheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT ACT_4 ACT_6 DUF2129 URO-D HTH_29
Motif
Other DBs
NCBI-GeneID: 938171
NCBI-ProteinID: NP_390669
Pasteur: BG10913
BSORF: BG10913
UniProt: P21204
Position
complement(2852157..2852600)
Genome map
AA seq 147 aa AA seqDB search
MKEETFYLVREDVLPDAMRKTLEVKKLLDRKKADSVADAVQKVDLSRSAFYKYRDAVFPF
YTMVKEQIITLFFHLEDRSGALSQLLQAVADSGSNVLSIHQTIPLQGRANVTLSISTSAM
EEDIHTLMNKLRKFDFVEKVEILGSGA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggagacattttatcttgtccgtgaagatgtattgcccgatgcaatgagaaaa
acattagaagtcaaaaagctgcttgatcgaaaaaaagcagattcagtagcagatgccgtt
caaaaggtcgatttaagtagaagtgcgttttataaatacagggatgctgtttttccattc
tacaccatggtaaaagaacaaattatcacacttttctttcatttggaggataggtcaggt
gcgttatctcagcttcttcaggcggtagctgattctggaagcaacgttctttccattcac
cagaccattccgcttcaaggcagagcaaatgtgacactgtctatcagtacgtcggcaatg
gaagaagacattcatacattaatgaataagctcaggaagtttgattttgtagaaaaggtt
gaaatattaggttcaggtgcataa

DBGET integrated database retrieval system