KEGG   Bacillus subtilis subsp. subtilis 168: BSU27920Help
Entry
BSU27920          CDS       T00010                                 

Gene name
obgE
Definition
(RefSeq) GTPase ObgE
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU27920 (obgE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     BSU27920 (obgE)
Ribosome biogenesis [BR:bsu03009]
 Eukaryotic Type
  Other ribosome biogenesis factors
   BSU27920 (obgE)
 Prokaryotic Type
  GTPases
   BSU27920 (obgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG DUF1967 MMR_HSR1 FeoB_N RsgA_GTPase Arf MMR_HSR1_C MeaB AAA_18 GTP_EFTU PduV-EutP MMR_HSR1_Xtn
Motif
Other DBs
NCBI-GeneID: 937502
NCBI-ProteinID: NP_390670
Pasteur: BG10337
BSORF: BG10337
UniProt: P20964
Structure
PDB: 

Position
complement(2852661..2853947)
Genome map
AA seq 428 aa AA seqDB search
MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY
KKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGG
RGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLLSVVSS
AKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVI
VHVIDMSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKL
TDDYPVFPISAVTREGLRELLFEVANQLENTPEFPLYDEEELTQNRVMYTMENEEVPFNI
TRDPDGVFVLSGDSLERLFKMTDFSRDESVKRFARQMRGMGVDEALRERGAKDGDIIRLL
EFEFEFID
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtagatcaggtcaaagtatatgtaaaaggcggcgacggcggcaacggtatggtt
gcgtttcgccgtgaaaaatatgtgccgaaaggcggccctgccggcggtgacggaggaaag
ggaggagacgtcgtttttgaagtagatgaaggtctccgcaccctgatggattttagatac
aaaaaacactttaaagcgattcgcggcgagcatggcatgtccaaaaaccagcacgggcga
aatgctgatgatatggtcattaaagttccgccgggcaccgttgtgacagacgatgataca
aaacaggtcatcgctgatttaacagagcacggacagcgggctgtcattgcaagaggcgga
agaggcggaagaggaaatagccgctttgctacaccggctaatcccgcgcctcagctttca
gaaaacggcgagccgggaaaagaacgctacattgttcttgaattaaaagtgcttgcagat
gtcggacttgtcgggttcccgagtgtgggaaaatctactttgctgtctgttgtctcatct
gcaaaaccgaaaattgcggactatcactttacaacgcttgtcccgaatctcggcatggtt
gaaacggatgacggacgcagctttgtcatggctgatttgccagggctgattgaaggcgca
caccaaggcgtcggactgggccaccagtttttgcgccatattgaacggacgagggttatt
gttcatgtcattgacatgtcaggcttagaaggccgtgatccatatgatgattatcttacg
attaaccaggagctgagcgagtacaatctgcgtctcactgagcgtccgcaaattatcgtt
gcaaataaaatggacatgccggaggctgcggaaaatctcgaagcctttaaagaaaagctg
acggatgattatccggtattcccgatcagtgcggtgacaagagaaggtctgcgtgagctt
ctgtttgaggttgccaatcagcttgagaacacaccggaattcccgctgtatgacgaggaa
gagcttacacaaaaccgtgtcatgtacacgatggaaaatgaagaagtgccatttaacatt
acacgcgatccagacggtgtatttgtgctttcaggagacagccttgagcggttattcaag
atgactgatttctcacgtgatgaatcggttaaacggtttgcaagacagatgcgcggaatg
ggtgttgatgaagcactcagagaacgcggagccaaggatggagatataatcaggcttctg
gaatttgaatttgaatttattgattaa

DBGET integrated database retrieval system