KEGG   Bacillus subtilis subsp. subtilis 168: BSU27930Help
Entry
BSU27930          CDS       T00010                                 

Gene name
spo0B
Definition
(RefSeq) sporulation initiation phosphotransferase B
  KO
K06375  stage 0 sporulation protein B (sporulation initiation phosphotransferase) [EC:2.7.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU27930 (spo0B)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU27930 (spo0B)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     BSU27930 (spo0B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOB_ab SPOB_a
Motif
Other DBs
NCBI-GeneID: 935956
NCBI-ProteinID: NP_390671
Pasteur: BG10336
BSORF: BG10336
UniProt: P06535
Structure
PDB: 

Position
complement(2853981..2854559)
Genome map
AA seq 192 aa AA seqDB search
MKDVSKNQEENISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVI
DAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHL
FDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEI
TSHECLIEIGLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtttcaaaaaatcaagaagaaaatataagcgacacggcattaacaaacgaa
ctgattcatctgcttggccattcccggcatgattggatgaataagctgcagctgattaaa
ggaaacttaagcttacagaagtatgaccgtgtctttgaaatgattgaagaaatggttata
gacgcaaagcacgaatcaaagctctcaaacctgaaaacaccgcatttggcgtttgatttt
cttacgtttaattggaaaacccattatatgacgcttgaatatgaagttctcggagaaatt
aaggatttgtcggcttatgatcaaaagctggcgaaactgatgagaaagctgtttcatctg
tttgatcaagcagtcagcagagagagtgaaaatcatttaacggtttcgcttcaaacggat
catcctgacagacagctgattctgtaccttgattttcacggcgcctttgccgatccatct
gcttttgatgatattcggcagaatggatatgaggacgttgatatcatgcgttttgaaatc
acgagtcacgaatgtctgattgaaattgggttggactag

DBGET integrated database retrieval system